KEGG   Vanderwaltozyma polyspora: Kpol_495p3Help
Entry
Kpol_495p3        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:vpo03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:vpo04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 311 aa AA seqDB search
METSAVDIDNIIDRLLEVRGSKPGQQVDLQEHEIRFLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
SMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK
SLPRQQGRKKK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagacttctgctgtggatatagataatatcattgatagattactagaggttagaggt
tcaaaacctggccagcaagtggatttgcaagaacatgaaattagattcctttgctcaaag
gcaagatcaatatttataaaacaacctattttactagaactagaagccccaattaaaata
tgtggtgatattcacggtcaatattatgatttattacgtctattcgaatatggtggattc
cctccagaatcaaactacttattcttgggtgattacgtcgatcgtggtaaacaatctcta
gagactatttgtttattgttggcttataaaattaaatatcctgaaaatttcttcatctta
agaggtaatcacgaatgtgcctccattaatagaatttatgggttttatgatgaatgtaaa
agacgttacaatattaaactttggaaaactttcacagattgtttcaattgtttgcctatc
gccgccatcatcgatgaaaaaatcttctgtatgcacggtggtttatccccagatttaaat
agtatggaacaaattagaagagttatgagaccaaccgatatacctgatgtcggtctatta
tgtgatcttttatggtcagatcctgataaagatatagtcggttggagtgaaaatgataga
ggtgtctccttcacttttggtcctgatgtcgttaatagattcttacagaaacaagatatg
gaattgatttgtagagcgcatcaagttgtcgaagatggttatgaattcttcagtaaaaga
caattggtaaccctgtttagtgctccaaactattgtggtgaatttgataatgcaggtgca
atgatgagtgtggatgaatctctattgtgttctttccaaattttaaaaccagctcaaaaa
agtttaccaagacaacaaggtagaaagaagaaataa

DBGET integrated database retrieval system