KEGG   Vanderwaltozyma polyspora: Kpol_499p18Help
Entry
Kpol_499p18       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Kpol_499p18
Enzymes [BR:vpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Kpol_499p18
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 700 aa AA seqDB search
MHFSLIFGLCLFLFNLSSATKFGLLSGDKESNDVVKKDFELPEPLTVNNFKSELQKGLHI
VEFYSPYCSHCKGLIPIWKETILDIGNEGKDVGLKFSQVNCIESGDICNEEDIDFFPDIR
LYGPSGYIKSFPQFEERSKEKLLAFAREAISDKSNLDIITKSNSKLMSGNTLSKLIKEGG
NERGILVSFWPTRNMRNTDDKLLFYNCEDCKAFQRTWSQISELANENDIETVHINCDSYK
GTCQELGFHELTDPGASNRQPRIGYILPNSNMKKFWSYTENSSPNPNSILSWALRIKQNS
EVPEFSEKLLSKIISFDPTTLLKHSSFQPGLHVVYTYNYDIGRESQISDETLASYLERLS
SVPNTNVYKAEPKMLLNLKKSYNYFLNTINYNKTEPTKFLDEEYFNLYSTSVIPTFMIFR
DGDSRPYVYHRSTDETEAQMIENLEDLIRDLKYTILPEAKDNDIERIYYTLSESVRYILI
QLVDSSNQKDSMGFLKKAIAAIYDYDYVCWKFIVDHFKQVSDQGEQILQRLKENEPLQAD
ATNYITGYLKWINKASVQAVYIDVSKNKNLLKYLGITKLPENYGFGDVLLLDRYKNLLYD
HDVFGKKLTASNSFVLKETILSLTLPNYSGFKYTIKPQKFKLKYRVPGSVDLVSILICIL
VFFLVLIFLIKMMKIYKKNKKYDKKRSIGLLGKSQKKLKD
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgcatttctcgttgatatttggattatgcctatttttatttaatctgtcttctgctact
aaatttggtttattatctggggataaagaatctaatgatgttgtcaagaaagatttcgaa
ctacctgaacctttgacggttaataatttcaaatcagaattacaaaagggtttacatatt
gttgaattctacagtccttattgttcccattgtaaaggtttaataccaatttggaaagaa
accattttagatattgggaatgaaggtaaagatgtagggttgaagttctctcaagttaat
tgtattgaaagtggtgatatttgtaatgaagaggatattgattttttcccagatattagg
ctatatggtccttctggttacatcaaaagcttcccgcaatttgaagaaagaagtaaagaa
aagttattagcatttgctcgtgaagcaatatcagacaaatctaatctagatataattaca
aaaagtaatagtaaattgatgtctggaaataccttatccaaacttataaaggaaggaggg
aatgaaagggggatcttagtatcattttggcctactagaaatatgagaaatactgatgac
aaattattattttataattgtgaggactgtaaagctttccaaagaacatggtctcaaata
tctgaattagcaaatgaaaatgatatagaaacagttcacattaattgtgactcatataaa
ggaacgtgtcaggaattgggattccacgaattaacagatcctggtgcttctaataggcaa
ccaagaataggatatatcttacctaacagcaatatgaaaaagttttggagctacactgaa
aatagttcaccaaaccctaatagcatactatcctgggctttaagaattaaacaaaatagt
gaagtacctgaattttctgaaaaattgttatccaaaattatatcatttgatccaactacc
ttattgaaacattcaagtttccaacctggtttgcacgttgtatatacatataattatgat
ataggaagggaatcgcagataagcgatgaaacattggcgagttatttggaacgtttgtct
tcagtaccaaatacaaatgtgtataaagctgagccaaagatgctcttgaatctaaaaaaa
tcgtacaattacttcctgaacacgattaattataataaaactgaaccaacaaagtttttg
gatgaggaatattttaatttatattctacgtcagtaataccaacatttatgatttttagg
gatggtgattcaagaccatatgtatatcacagatctactgatgaaacagaagctcagatg
attgaaaatttagaagatttaattagagatttaaagtatactattttaccagaagcaaag
gataatgacatagaaagaatttattacactttgtctgagtctgtaagatatatattgatt
caactggttgattcgagtaatcaaaaagacagcatgggttttttaaagaaagctattgca
gcaatttacgattatgactacgtttgctggaaattcattgtagatcattttaagcaagtt
tctgatcaaggggagcagatcttgcaaaggctgaaagaaaatgaacctctacaggctgat
gccactaattatattactggatatttaaaatggattaataaggcctctgttcaagcagta
tatattgatgtctcaaaaaacaaaaatttattgaaatatttaggaattacaaaactacct
gaaaattacggattcggggatgttttattattggatagatataagaatctgttatatgat
catgacgtttttggtaaaaaactgactgcgtcaaattcttttgttctaaaggaaacaata
ttatcattaactttaccaaattattctggtttcaaatacacaataaagccacagaaattt
aagctgaagtatagagtccccgggtccgttgacttggtttcaattctgatctgtattcta
gtgtttttcttggttttgatattcttaataaaaatgatgaagatatacaaaaagaataaa
aaatatgacaagaaacgtagtatcggtttgctaggaaagtctcaaaaaaaactaaaggac
tga

DBGET integrated database retrieval system