KEGG   Vanderwaltozyma polyspora: Kpol_499p3Help
Entry
Kpol_499p3        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
vpo  Vanderwaltozyma polyspora
Brite
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Kpol_499p3
Protein kinases [BR:vpo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Kpol_499p3
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Kpol_499p3
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 374 aa AA seqDB search
MSRTITFDIPSHYQLVDLIGEGAYGTVCSAVHKPSGTKVAIKKIQPFGKTMFVTRTLREL
KLLKYFHNHENIISILDKVRPISIDNLNAVYIVQELMETDLQKVIVNNNRKNTPLSDDHI
QYFTYQVLRALKSIHSAKVIHRDLKPSNLLLNSNCDLKICDFGLSRCLASSSDSKETLVG
FMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILE
VLGTPSYDDFEQIKSKRAKEYIANLPFKSRLPWEMVLGREKDTLNPGILDLLEKMLTFNP
HKRISAEDALNHPYLATYHDPQDEPVYQPLNLEDDEFWKVDNQSKDPSSNEDEESLLSMD
KLKQMLYDEILTPL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtacaattacttttgatataccttctcactaccagttggttgatctaattggt
gaaggtgcctatggtactgtatgttcagcagtgcataagccatcaggaacaaaagttgca
attaaaaagattcaaccttttggtaaaaccatgtttgtcacaaggacgttacgtgaattg
aagttattaaaatattttcataatcatgaaaatattattagtatattggataaagtcaga
ccaatatcaattgataacctgaatgctgtttatattgtgcaagaactaatggaaactgac
ttgcaaaaagttattgttaataacaataggaagaacacacctttaagtgatgatcatatt
caatattttacttaccaagtattacgtgctttaaaatcaattcatagtgcaaaagtgata
catagagatttaaaaccatcaaatttgcttctgaattcaaattgtgatttaaaaatctgt
gattttgggctttcaagatgtttagcaagtagtagtgattcaaaggagactttggttgga
ttcatgacagagtatgttgctacaagatggtatcgtgcaccagaaattatgttaactttc
caagaatatactacggcgatggatatttggtcttgcggttgtatactggctgaaatggtt
tcaggtaaacctttattccctggtagagattaccatcatcaactatggttaatattagaa
gtattgggtacaccttcatatgacgattttgaacagataaaatctaagcgtgcaaaagag
tacattgcaaatttaccatttaaatcaagactaccttgggaaatggtattaggtagagaa
aaggatacattaaatccaggtattttagatttattagaaaaaatgttgacttttaatcca
cataaacgtattagtgcggaggatgcactaaaccacccttatttggcaacctatcatgat
ccacaagatgaacctgtataccaaccattaaatttagaagatgatgaattttggaaagtt
gataatcaatcaaaggatccgtcttctaatgaagatgaagaaagtctgctttcaatggat
aaattaaaacaaatgttatatgatgagatattaactccactgtag

DBGET integrated database retrieval system