KEGG   Vanderwaltozyma polyspora: Kpol_513p12Help
Entry
Kpol_513p12       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
vpo  Vanderwaltozyma polyspora
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1532 aa AA seqDB search
MTVSYGPHPLKPLNTNTRHGFDEQYNSEQFLETLAQNFIFYFDDKRHRRNGNPTPENEIL
EDEDSYFQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDVIKTNPCARIEAGVDALTFQD
SKKAIEQIGKNLQSQYETLSLRTRFKQSLDPCVEDVKRFCNSLRRTSKDDRILFHYNGHG
VPKPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNSAGNIVTNFQNFVQKRI
KDDESGKHDVAAPSPTSAYKECFQLASCRADELLLMAPELPADLFTCCLTNPIDISVKVF
LMQSHLKNSKYKVFFESSNEFSSDEKEFPELKTPNIKVPGMLSDRRTPLGELNWIFTAIT
DTIAWTSLPRPLFKKLFRHDLMVAALFRNFLLAKRIMPWYNCHPVSDPSLPESIAEHPMW
KSWDLALDEVLSKLVDSLENNPQARTTDATTLFRQQDTAQNQQPKQQQQQLKQQQEVKPG
SIQNHSRFAVGNLSTMSLATHPALNNQKRSSTVNFQNGVQPVQKQFTGFFEQNLTAFELW
LKYASNTRNPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKL
LQSPAPELKPILVFIWARIMAIDYKSIQADLLKERGYVYFVSILVPDWNSPQLPTSSSSL
NNGSPLTMTAKPSVSILRNQSSQQLGNNSIDTITNHYSNETTDDQKAMAVFILSAFIRDF
PHGQKQCFNMDLVKRLCYYIDNSGVPLLRQWSIILLGQFFEKHPLHRYICMELGVLDSIL
KSLNDPVPEIRAASLLSLSSYISDPDESEILLRLQQELEQQYQQLHTQLQQIQNATHQQY
QQIEQQQMKIERQLQHCQEIQSKLQNVDFEKLKEQSISNLISILPLINDGSPLVRKEIII
YFSKVVNRYINFFIVVAFDLLNEEITQLEGIGKNKDLNEKSTFSQGSIFSSIWKGLLILA
SDPFPENSVLAGKIIDYILIEISFHKDLGPPFLKMEEYLIKRSSNLNQNGSKGFDASQVQ
VIGRNNNQASNNNSEEILSDESSHHDELQGQFFLTKFFSTLGFKDHDDKGYSSSTTHTQT
PKSDSSGNRSSNGSGLKSNGGGVKKETEQIILPLQSSLLTYCYEYFQEPQMRKQETDEPG
SVNYNIRIWRRNRNEKIIEETQAEKTLSLYGDWSNRLITFDNKSQPKIMEFTQFDDYLVV
ADERDYITVYDWEKDSVISRFSNGNPFGTKVTSLKFINEDDSSLLMTGSSDGIVNIYKGF
DDIESNQVVTAWRGLTDMLLTPRSSGLLIDWQQIRGSLLATGDVKVIRIWDAHSETVEID
IPAKTSSLVTSITSDQLAGDIFVCGFADGTLRAYDRRLDPRDAMVRLWRTSSNRNSRSAI
TNVHLQRGGYRELASGTANGMVELWDIRSQDSVSSFNVGGSNMEQSGTQKMTTMTCMQLH
EHVPVIATGTKQINLWTTSGDLLSSFNNVHHNGGVAGTLAVSGIRSTLTSNLSSSTSFLS
SLALHPHRMMLSASNSHDTKISIYTCHKKKFE
NT seq 4599 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttcttatggtcctcaccctttgaaacccttaaatacaaatacgagacatggg
ttcgatgaacaatataatagtgaacagtttttagaaactctagcacaaaactttatcttt
tattttgatgataaaaggcacagaagaaatggtaatcctactccagagaatgaaatactt
gaagatgaagatagttatttccaacctattacagattggaaaattatgaaggatagacag
aaaactgtgagtgctgctcttttactatgtcttaacttgggtgttgatccaccagatgtt
ataaagactaatccatgtgcaagaatcgaagccggtgttgatgcattgacttttcaagac
tctaagaaagctattgaacaaataggtaagaacttacaatctcaatatgagacattgtct
ttaagaactaggttcaaacaaagtttagatccttgtgtggaagatgtgaaaagattttgt
aactcgctcagacgaacttcaaaggatgatagaatattgtttcattacaatggccatggt
gttcctaaacctactccttcaggtgaaatttgggttttcaatagagggtacacacaatat
attccagtttctttgtatgatttgcaaacttggttaggtgctccatgtatatttgtttat
gattgtaacagtgcaggtaacatagttacaaatttccaaaattttgtacaaaaaagaata
aaagatgatgaaagtgggaaacatgatgttgcagctccatctccaacgtcagcatataaa
gaatgcttccaactagcatcttgtagagccgatgagttgctattaatggcacccgaatta
cctgctgatttattcacatgttgtctaactaacccgattgatattagtgttaaagtattc
ttaatgcaatcgcatttaaaaaattcaaagtacaaagtgtttttcgaatcttctaacgaa
ttcagctctgatgaaaaagaatttccagaattaaaaacaccaaatattaaggtcccaggg
atgttatctgatagaaggactcctttgggagaattaaattggatttttacagcaattact
gacacgatagcatggacatctttaccaaggcctctttttaaaaagctttttagacatgac
ctaatggtcgctgcattattcagaaactttttattagcaaaaagaattatgccttggtat
aattgccatcctgtatctgatccctcattgccggaaagtatagccgaacatccaatgtgg
aaatcttgggatctggctctagatgaagtcttaagcaaattggttgacagcttggaaaat
aaccctcaagcccgtacaacagatgcaactacgctatttagacagcaagatactgcccaa
aatcagcaacccaagcaacaacagcaacaacttaaacaacaacaggaggtaaaacctgga
agcattcagaatcattcaagatttgcagttggaaatctaagtacaatgtcattagcaaca
catcctgcattaaacaatcaaaaaagatcaagcacagtaaattttcaaaatggagtgcag
ccagttcagaaacaattcactggattttttgaacaaaacctaactgcatttgagctctgg
ttaaaatatgcatcaaatacaagaaatcctccagagcaattgccaattgttcttcaagtc
ttattatcacaggtacatcgtattagagcattagtacttttatctagatttttggatttg
ggtccatgggcagtctatttgtcactttcaattggtatatttccgtatgtattgaaacta
ttacaaagtcctgctcctgaactgaaaccaattttagtgtttatttgggcaagaattatg
gcgatcgactataaaagtatccaagcagatttgttaaaagaaagaggatatgtttacttt
gtgtcaatacttgttccagattggaattctcctcaactcccaacaagcagttcttctctg
aataatggatccccacttactatgacggctaaaccatcagttagtatcttaaggaaccag
tcatcccaacaattaggaaataacagtatagacactataactaatcattattccaacgaa
acgacagatgatcaaaaagcgatggctgtattcattttatctgctttcatcagagatttt
cctcatggtcaaaaacaatgcttcaacatggatttggtaaaaagattgtgttattacatt
gataattcaggagtaccacttttaagacaatggtcgattattcttctaggtcaatttttt
gaaaaacaccctttgcacaggtacatatgcatggaattaggtgtccttgactcgatattg
aagtctttaaatgatccagtccctgagataagagctgcaagtttactgtcattatcgtcc
tatatttcagatccagacgaatctgaaattcttttaaggctacagcaagaactagaacaa
caatatcaacaattacatactcaattgcaacaaatacaaaatgctactcatcaacaatat
caacaaattgagcaacaacaaatgaaaattgaacgtcagctacagcattgtcaagaaatt
caatctaagcttcaaaatgttgattttgagaagcttaaggagcaaagtatatctaatttg
atatcaattttaccattaatcaatgatggatcacctcttgtaaggaaggagattattatt
tatttttcaaaagttgttaataggtatatcaacttttttatcgtagttgcatttgatctt
ttgaatgaagaaataacacagctagaaggtattggtaaaaataaagatctcaatgagaag
tcaactttcagtcaaggatctattttcagttctatttggaaaggtttgttaatattagca
agtgatccattcccagagaatagtgtattggcaggaaaaattattgattatattctaata
gaaattagctttcataaagatttagggcctccatttctcaaaatggaagaatatttaata
aagagaagctcgaatttgaaccaaaatggctctaagggatttgatgcctcacaagtacaa
gtaataggaaggaataataaccaagcatcaaataacaattctgaagaaatactgagcgat
gaaagcagtcaccatgatgaattacaaggacagttctttttgacaaagttttttagtact
cttggatttaaggatcatgatgataaaggatatagttcatcaactacacatactcaaacc
ccaaaatcagattccagtgggaaccgttcttctaacggttcggggttgaaatcaaatggt
ggtggagttaaaaaagaaacagaacaaattatacttccacttcaaagttcactcctaact
tattgttacgaatattttcaggaacctcagatgagaaaacaagaaacggatgaaccaggg
agtgtaaattataatattcgaatttggagaaggaataggaatgaaaagattattgaagag
actcaggctgaaaagactttgtctctgtatggagactggtctaataggttaataacattt
gataataaatcccaaccgaaaattatggaatttacacagtttgatgattatttggttgta
gcagatgaaagagattatattactgtatatgattgggaaaaagattcggtaatatctaga
ttttctaatggtaatccttttggtactaaagttactagtttgaaattcatcaacgaagac
gattcatctcttttgatgactggttcctctgatggtatagttaatatttacaaaggattt
gatgacattgaatctaatcaagtagttactgcttggagaggtttgacagatatgttgctt
actccaagatctagtggattattaatagactggcagcaaattcgtgggtcactgctcgct
actggtgacgttaaagtaattaggatatgggatgctcattctgaaaccgtagagatcgat
attccagctaagacatcttctttagtcacttctattacttcggatcaattagcaggggat
atttttgtatgtggttttgcagatggtacattaagggcatacgatcgtagattggatcca
agagatgcgatggtacgtttgtggaggacttcttctaatagaaattctcgttccgctatc
acaaatgttcatttacaaagaggcggttacagagaattagctagtggtactgctaatggt
atggttgaactgtgggatataagatcccaagatagtgtatcgtctttcaatgtgggaggt
tcaaatatggaacagagtggaactcaaaagatgactacaatgacatgtatgcaattgcat
gaacatgtacctgtaattgctacaggtacgaaacagatcaacctttggacaacttctggt
gatttgctttctagttttaataacgtacaccataatggtggtgttgctggaactcttgca
gtctctggtataagatcgacactaacttcaaatttatcctcttcaacttcctttttatcg
tcattagcattgcatcctcatagaatgatgttgtcagcttccaattctcatgatacaaaa
atcagtatatatacatgtcataaaaagaagtttgaataa

DBGET integrated database retrieval system