KEGG   Vanderwaltozyma polyspora: Kpol_530p41Help
Entry
Kpol_530p41       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    Kpol_530p41
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Kpol_530p41
Protein kinases [BR:vpo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Kpol_530p41
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 538 aa AA seqDB search
MQKIQAQQQPLFQKKTLQRRNMKHLRLNDASLKMPLPSIPDKSTINISNNENNSHEANET
GHVVELKLPNSIDNDDDNIANNISISINKVDNFKSNDGDVRTTNNKDNNNNDNENKNHNN
NFSLRRNFKRNLTLDISSNDNNRINISGNNVIIQKNEIIDPISSSSSTNDNSSITTPEEK
VSNLKNSLLLHQKDINDNKIELQNLVQLGKIGSGNSGTVIKALHVPDSRIIAKKTIPVET
NNELVINQLLRELTIMRSVKAHPNIVEFYGAYYDQSSNNELVILLEYMNCGSLDKILSVH
KAFCQRNKASPDKSWFNELAISKISYAVLTSLSYLYKNYKIIHRDIKPSNVLINSKGQVK
ICDFGVSKKMVNSIADTFVGTSTYMSPERIQGNVYSTKGDVWSLGLMIIELVTGEFPLGG
INDTPDGILDLLQRIVNEPSPRLPSNLDETRYKREITDFVNRCCVKNERERSSIEELLCH
DFVTKYSSAENDKEFKHWCKKMKNYIKSEKQLKKEETERMKFEKKQLERSAAAAVSKR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagatacaggctcaacaacaaccgttgtttcagaagaagactcttcaaagacga
aacatgaaacacttgagacttaacgatgcaagtttgaaaatgccattaccatcgataccg
gataaatctactattaatatttcgaataatgaaaataatagtcatgaggcaaatgaaact
gggcatgttgtagaactaaaattaccaaatagtattgataatgatgatgataatatcgcc
aacaatattagtattagtattaacaaagttgacaactttaagagtaatgacggtgatgtg
aggacgaccaataataaagataataataataatgataatgagaataaaaatcacaataat
aatttttcactgcgaagaaacttcaaacgaaatttaaccttggatatatcatcaaatgat
aataacagaataaatataagcggtaacaatgtcataatacaaaagaatgaaatcattgat
ccaatttcttctagcagttctacaaatgataattcttctataacgactccagaagaaaaa
gtatcgaatttgaaaaattccttactactacatcaaaaggatattaatgacaacaaaatc
gaactacagaatttagttcaactggggaaaataggttcaggtaactcaggtacagttata
aaggcattgcatgtaccagattcaagaattattgctaagaaaacgatacccgtagagaca
aataatgaattagtaataaatcaattgttaagagaattaacgattatgagaagtgtaaag
gctcatccaaatatagttgaattttatggtgcatattatgatcagtcatcgaataatgaa
ttggtcattctattagaatatatgaactgtggttcgttagataaaatactatcagtacac
aaagctttttgtcaaaggaataaagcatctcctgataaatcatggtttaatgaattggcg
atttctaagatatcgtatgcagttctaacctcactttcttacctatacaagaattataaa
attattcatagagacattaaaccatctaatgttctgattaacagtaaaggacaggtgaaa
atatgtgattttggtgtatcaaagaaaatggttaattcaatagctgacacttttgtcggt
acctctacatacatgtcaccagaacgtattcaaggtaatgtatactccacaaagggtgac
gtttggtcattgggtttgatgattatagaattagttactggtgaattcccattaggtggt
attaacgatactccagatggtatattagatttactacagagaattgttaatgaaccatct
ccaaggttgccatcgaatttggatgaaactaggtataaaagggaaatcaccgattttgtg
aatagatgctgtgttaaaaatgaaagagaaagatcatcgatagaagaattgttatgtcat
gattttgttactaagtattcatcagcagaaaatgataaagaatttaaacattggtgtaaa
aaaatgaagaattacataaaatcagagaagcaattgaagaaagaagaaaccgagaggatg
aagtttgagaagaaacaattagaacgttctgctgcagctgcagtatcaaagaggtga

DBGET integrated database retrieval system