KEGG   Vanderwaltozyma polyspora: Kpol_534p24Help
Entry
Kpol_534p24       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:vpo00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:vpo00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 163 aa AA seqDB search
MTSKFYDHKPLDSDGNVYSFEEHLKGKVVLIVNVASKCGFTPQYKDLENLYREYHEKGFV
ILAFPCNQFGHQEPGTDEEIGRFCALNFGVSFPIMKKIDVNGVNTDPVYEYLKNEKVGSL
GLKGVKWNFEKFLVDRNGTVTNRFSSLVGPTSIEQNIIELLKE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaaattttatgatcataaaccattggacagtgatggcaatgtttattcattt
gaagaacatttaaagggtaaagttgtattgatagtcaacgttgcatcgaagtgtggtttc
actccacagtataaagatttagaaaatctgtacagagaatatcacgaaaagggatttgtg
attctagcattcccatgtaatcagtttggccatcaagaacctggtactgatgaagaaatt
ggtaggttctgtgcattaaattttggtgtttcattcccaatcatgaagaagattgatgtt
aatggtgtcaacactgatccagtctatgaatatttaaaaaatgagaaagttggtagtcta
ggattgaaaggtgttaaatggaattttgaaaaattcttggttgacagaaatggtactgtc
actaaccgtttctcatcattagttggtccaacaagtattgaacaaaatattatagaatta
ttaaaggaataa

DBGET integrated database retrieval system