KEGG   Vanderwaltozyma polyspora: Kpol_534p24Help
Entry
Kpol_534p24       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Kpol_534p24
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Kpol_534p24
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Kpol_534p24
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 163 aa AA seqDB search
MTSKFYDHKPLDSDGNVYSFEEHLKGKVVLIVNVASKCGFTPQYKDLENLYREYHEKGFV
ILAFPCNQFGHQEPGTDEEIGRFCALNFGVSFPIMKKIDVNGVNTDPVYEYLKNEKVGSL
GLKGVKWNFEKFLVDRNGTVTNRFSSLVGPTSIEQNIIELLKE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaaattttatgatcataaaccattggacagtgatggcaatgtttattcattt
gaagaacatttaaagggtaaagttgtattgatagtcaacgttgcatcgaagtgtggtttc
actccacagtataaagatttagaaaatctgtacagagaatatcacgaaaagggatttgtg
attctagcattcccatgtaatcagtttggccatcaagaacctggtactgatgaagaaatt
ggtaggttctgtgcattaaattttggtgtttcattcccaatcatgaagaagattgatgtt
aatggtgtcaacactgatccagtctatgaatatttaaaaaatgagaaagttggtagtcta
ggattgaaaggtgttaaatggaattttgaaaaattcttggttgacagaaatggtactgtc
actaaccgtttctcatcattagttggtccaacaagtattgaacaaaatattatagaatta
ttaaaggaataa

DBGET integrated database retrieval system