KEGG   Vanderwaltozyma polyspora: Kpol_538p39Help
Entry
Kpol_538p39       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
vpo  Vanderwaltozyma polyspora
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Kpol_538p39
Translation factors [BR:vpo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Kpol_538p39
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 726 aa AA seqDB search
MSAALEDIKLEDIPVDDIDFSDLEKQYSVNDTVSFDQYIVVCGAPVIPEGKVAVLKKALT
GLFSKAGKVVDIEFPIEDGKTKGFLFVECASPADGNKIIKAFHTKRLDLKHRLFIYTMRD
VEKYNDKNFPTEFVEPEIPDFFPTSTLKSWLSDEDGRDQFVLQANEMTTVLWNSAIEDEE
SVVESRKNWSTNYIRFSPKGTYLFSYHPQGVVMWGGPHFDRLRRFYHPNVRTSSVSPSEK
FLVTYSPDPIVVDEEDADCPFTKKNEGHQLCIWDIDSGLLQSTFPVVKSSYLQWPLVRWS
YNDQYCARMVGETLVVHDVKKGFAVMDNKTLKVPGIRDFSFAPTGVKIAPFRANDKESVI
LAYWTPETNNMSCKATIVDVERSRVLKTVNLVQVSNVTLHWQSDSEFLCFNVERHTKSKK
TQFSNLEICKLTEKDIPGDKIELKDCVVDFAWEPHGNRFGVIAVRETGDDNIAIPKNVAT
FFAPEKRDVKDKSTGVKKWLEVASITDKFSNTISWSPAGRYVVVATLVKPNVRRSDFVFY
DMDFATDKNMNVTKDVHASLKEVATNSFPSATDMAWDPSGRFLAVWSSSLKHKMENGYKV
FNVAGTIVKEEPLNSFKNFAWRPRPASLLTNAEKKKIRKNLKEWTAQFAEQDAMEADAAT
RDMILRQREMLKDWTEYRAEIGARFEEEFGYKTFNMIPLSNSEDDFTSVEEVKEEVLEES
EEKVVE
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgctttagaagatatcaagcttgaagatattcctgtcgatgatattgacttc
tccgacttggagaaacaatattctgtcaatgacactgtctcatttgatcaatacatcgtt
gtttgcggtgctccagttatcccagagggtaaggttgctgtcttgaagaaggctttgact
ggtttgttctccaaggctggtaaagttgttgatatcgagttcccaattgaagacggtaag
actaaaggtttcttatttgtggaatgtgcctctccagctgatggtaataagattatcaaa
gctttccacaccaagagattggatttgaaacatcgtttgtttatctacaccatgagggat
gtcgaaaaatacaatgacaaaaacttcccaactgaatttgttgaacctgaaattccagac
tttttcccaactagtactttgaaatcttggttatcagatgaagatggtagagatcaattt
gttttacaagccaacgaaatgactactgtcctatggaattctgctattgaagatgaagaa
tctgttgttgaatctagaaagaattggtctacaaactatattagattctctccaaagggt
acttacttgttttcataccatccacaaggtgttgtcatgtggggtggtcctcactttgac
cgtttgagaagattctaccatccaaatgttagaacttcctctgtttctccttctgaaaaa
ttcttagttacttactctccagatccaattgttgtcgacgaagaagatgcagactgtcca
tttaccaagaagaatgaaggccatcaattgtgtatctgggatatcgattctggtttatta
caatctaccttcccagttgtcaagagttcttacttgcaatggccattggttagatggtct
tacaatgatcaatactgtgctcgtatggttggtgaaactttggttgtccacgatgttaag
aagggttttgccgttatggacaacaagaccttgaaggttccaggtattagagatttctct
tttgctccaaccggtgttaagatcgcaccattcagagctaatgataaagaatcagtaatt
ttggcttactggactcctgaaactaacaatatgtcttgtaaggctactattgtcgatgtt
gaacgttctagagttttaaagactgttaatttggttcaagtttctaatgtcacactacat
tggcaatcagactctgaattcttatgtttcaatgttgaacgtcacactaaatctaagaaa
actcaattcagtaacttggaaatctgtaaattgactgaaaaggatattccaggtgacaag
attgaattgaaggattgtgtcgtcgatttcgcttgggaaccacatggaaacagatttggt
gtcattgctgttcgtgaaactggtgatgataacattgctattccaaagaatgttgccact
ttctttgctccagaaaagagagatgtcaaagataaatctactggtgttaagaaatggtta
gaagttgcttctatcacggataaattttctaacaccatttcctggtctccagctggtaga
tatgttgttgttgcaactttagttaaaccaaatgttcgtagatcagacttcgttttctac
gacatggatttcgcaactgacaagaatatgaatgttactaaggatgttcacgccagtttg
aaagaagttgccactaacagcttcccatctgccaccgatatggcatgggatccatctggt
agattcttagctgtttggtccagttccttgaagcacaagatggaaaatggttacaaggtc
tttaacgttgctggtaccattgttaaggaagaaccattgaacagtttcaagaacttcgca
tggagaccaagaccagcttctttgttgaccaatgctgaaaagaagaagatcagaaagaac
ttgaaggaatggaccgcacaatttgctgaacaagatgctatggaagctgatgctgctacc
agagatatgatcttgagacaacgtgaaatgttgaaagactggaccgaatatagagctgaa
attggcgctagattcgaggaagagtttggttacaaaacatttaacatgattccattgagc
aattctgaagatgattttactagtgttgaagaagttaaagaagaagtcttggaagaatct
gaagaaaaagttgtcgaataa

DBGET integrated database retrieval system