KEGG   Vanderwaltozyma polyspora: Kpol_538p43Help
Entry
Kpol_538p43       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vpo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vpo00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vpo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vpo00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:vpo00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 692 aa AA seqDB search
MKDNTNNNNNNSNKKDYEYEHLTSTPIVIQKPIDDRLQPSLQHSYKPYLSGFEHYKQQYQ
LSIDDPESFFGTHARNHLDWSIPFNKVFIPDENGKPNFVNNNWFVNGQLNASYNCVDRHA
LSHPNKIALIYESDEPGKGYSLTYNQLLVQVSKVAQVLTYSMDVKKGDNVAVYMPMIPEA
IITLLAIARVGAVHSVVFAGFSSNSLRDRINDANCKAVITTDESIRGGKIIETKKIVDDA
LKETPCVSNVLVYKRTENKNVNYVQGRDLDWDAELKKYKNYFPCTPVDSEHPLFLLYTSG
STGAPKGVQHSTAGYLLGAALTTKYTFDVHPEDIFFTAGDIGWITGHTYVVYGPLLNGCT
TVIFEGTPTYPNCSRYWDIIDKYKVTQFYVAPTALRLLKRAGDSYIDGYNLSSLRALGSV
GEPIAPEIWEWYSEKIGKNDIPICDTYWQTESGSHLITTFAGGATPMKPGSASFPFFGVE
PVLLDANTGKEITDQDHCEGVLAIKRPWPSFARTIWKNHDRYTDTYLKPYPGYYFTGDGA
ARDKDGYIWILGRIDDVVNVSGHRLSTAEIESAIIEDATVAECAAVGFADDLTGQAVAAF
VVLKNKSSWSTASEEELQEIKKHLILTVRKDIGPFAAPKLIVLVDDLPKTRSGKIMRRIL
RKILAGEADQLGDVSTLSNPGIVKHLIDSVKI
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataataccaataacaataacaacaactccaataaaaaagattatgaatacgaa
catttaactagcacccccatcgtcatacagaaaccaatcgatgatagattacaaccttcc
ctacaacactcctacaagccttacttatcaggtttcgaacattataaacaacagtatcaa
ttatctatagatgatccagaatccttcttcggtacccatgctcgtaaccatttggactgg
tccattcctttcaacaaggtattcatcccagatgagaacggtaaaccaaatttcgtcaac
aacaattggtttgtcaatggtcaattgaacgcttcctataactgtgtagacagacacgct
ttatcccacccaaataaaattgccttgatttatgaaagcgatgaacctggtaaaggctac
tctttaacttataaccaactgttggttcaagtatctaaagtcgctcaagttttaacttac
tcaatggacgtcaaaaagggcgataacgtcgcagtttatatgccaatgatacctgaagct
atcatcactttgttagcaattgcaagagtcggtgccgttcattcagtggtctttgcaggt
ttctcctcaaactctttacgtgatagaattaacgacgctaattgtaaagccgttataact
acagatgaatctattagaggtggaaaaatcatcgaaaccaagaaaattgtagatgacgct
ttaaaggaaactccatgcgtctcaaatgtattggtttataaaagaacagaaaataaaaat
gttaattacgtccaaggaagagatttagactgggacgccgaattgaaaaaatacaaaaat
tatttcccttgtactccagttgatagtgaacatccgttattcttgttatacacttcaggc
tctaccggagctccaaaaggtgtacaacattcaactgcaggttaccttttaggtgctgca
ttgacaaccaaatacacatttgatgtccacccagaagatatattcttcacagctggtgat
atcggttggatcacaggtcatacttatgtagtttatggtcctctattaaatggctgtacc
actgtcatttttgaaggtactcctacttatccaaattgttctcgttactgggatatcatc
gacaaatacaaagtcactcaattctacgtcgcaccaactgccttgagattattgaaaaga
gctggcgattcatatattgatggctataatttatcttctttacgtgctttgggttcagta
ggtgagcctattgctcctgaaatttgggaatggtactcagaaaaaataggtaagaatgac
attcctatttgtgacacttattggcaaactgaatctggttctcatctaattacaactttt
gctggtggagccactccaatgaaaccaggttcggcttcattcccattctttggtgtagaa
cctgttttactagatgcaaacacaggaaaagaaatcaccgatcaagaccactgtgaaggt
gtattagcaattaaaagaccttggccatcttttgcaagaacaatttggaaaaaccatgac
agatacacagacacttatttgaagccttatccaggttactattttacaggagatggtgcg
gctagagacaaagatgggtacatttggattttaggccgtatcgatgatgttgtcaatgtc
tctggtcatcgtttatctactgcagaaatagaatctgcaattatcgaggatgcaacagtt
gcagagtgtgctgccgtaggctttgctgatgatttgacaggtcaagctgttgctgcattt
gtggttttgaaaaataaatctagttggtctactgcttcagaagaagaactacaagagatt
aaaaagcatttgatattaactgttagaaaagatattggtccttttgctgctcctaagttg
attgtattggttgatgatttaccaaagacaaggtcaggtaagattatgagacgtatcttg
agaaagatcttagctggtgaagctgatcaattaggtgatgtctcaactttgtcaaatcca
ggtattgtcaaacatttaatcgattctgttaagatatag

DBGET integrated database retrieval system