KEGG   Vanderwaltozyma polyspora: Kpol_543p55Help
Entry
Kpol_543p55       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    Kpol_543p55
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Kpol_543p55
Protein kinases [BR:vpo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Kpol_543p55
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 425 aa AA seqDB search
MATNEEFIRTQIFGTVFEITNRYADLNPVGMGAFGLVCSATDTLTAQPVAIKKIMKPFST
AVLAKRTYRELKLLKHLTHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
VQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDV
INTICSENTLKFVTSLPHRDPVPFSERFKAVEPEAVDLLEKMLVFDPKKRITAADVLVHP
YLSPYHDPTDEPVAEAKFDWHFNDADLPVDTWRVMMYSEILDFHKIGGTDGQIDTSATFD
DQVAAATAAAAQAQAQAEAQNQNLTQTQASLDALTNDPNFTALDETISNYGDQAIQYANE
FQQQH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaacgaagaatttataagaacccaaatctttggtacagtattcgaaattact
aataggtatgctgatttaaaccctgtaggcatgggtgcattcggtttggtatgttctgca
actgatacattaactgcccaacctgtagcaattaaaaaaattatgaagcctttctcaact
gcggttttagcaaaaaggacttatagagaattgaaattattgaaacatctaacccatgaa
aatttaatttgtctacaagatatcttcttatctcctttggaagatatatactttgtcact
gaattacaaggtacagacctacacagactgctacaaacaagacctttggaaaaacaattc
gttcaatattttttatatcaaatcttaagaggtttaaaatacgtccattcagcaggtgta
atacatagagatttgaaaccaagtaatatcttaattaatgaaaattgtgatttgaaaatt
tgtgatttcggtttagcaagaatccaagaccctcaaatgacaggttatgtctcaacaaga
tactatagagctcctgaaatcatgttgacttggcaaaaatacgacgtagaggtagatatt
tggtcagctggttgtatcttcgcagaaatgattgaaggtaaacctttattccctggtaag
gaccatgttcatcagttctctattattacagatttgttaggttcccctcctagtgatgtg
atcaacactatctgttctgaaaatacccttaaatttgtgacatctttgcctcacagagat
ccagttcctttctcagaaagatttaaagcagttgaacctgaggcggtagacttattagag
aaaatgttggtatttgatccaaagaaaagaattacagctgccgatgtattggtccatcca
tatttgtcaccttatcatgatccaactgatgaaccagtagcagaagccaaattcgactgg
cattttaatgacgctgatttaccagtagatacatggcgtgtaatgatgtattctgaaatt
ttagatttccataaaattggtggaactgacggccaaatcgatacaagtgccacttttgat
gatcaagttgccgcagcaactgcggctgctgctcaagctcaagctcaagctgaagcccaa
aatcaaaatctaacacagacacaagcatcgttggatgctttgactaacgatccaaatttt
accgctttggatgaaactatatcaaattatggagatcaagctatacaatacgcaaatgaa
ttccaacaacagcattag

DBGET integrated database retrieval system