KEGG   Vanderwaltozyma polyspora: Kpol_543p55Help
Entry
Kpol_543p55       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:vpo04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 425 aa AA seqDB search
MATNEEFIRTQIFGTVFEITNRYADLNPVGMGAFGLVCSATDTLTAQPVAIKKIMKPFST
AVLAKRTYRELKLLKHLTHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
VQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDV
INTICSENTLKFVTSLPHRDPVPFSERFKAVEPEAVDLLEKMLVFDPKKRITAADVLVHP
YLSPYHDPTDEPVAEAKFDWHFNDADLPVDTWRVMMYSEILDFHKIGGTDGQIDTSATFD
DQVAAATAAAAQAQAQAEAQNQNLTQTQASLDALTNDPNFTALDETISNYGDQAIQYANE
FQQQH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaacgaagaatttataagaacccaaatctttggtacagtattcgaaattact
aataggtatgctgatttaaaccctgtaggcatgggtgcattcggtttggtatgttctgca
actgatacattaactgcccaacctgtagcaattaaaaaaattatgaagcctttctcaact
gcggttttagcaaaaaggacttatagagaattgaaattattgaaacatctaacccatgaa
aatttaatttgtctacaagatatcttcttatctcctttggaagatatatactttgtcact
gaattacaaggtacagacctacacagactgctacaaacaagacctttggaaaaacaattc
gttcaatattttttatatcaaatcttaagaggtttaaaatacgtccattcagcaggtgta
atacatagagatttgaaaccaagtaatatcttaattaatgaaaattgtgatttgaaaatt
tgtgatttcggtttagcaagaatccaagaccctcaaatgacaggttatgtctcaacaaga
tactatagagctcctgaaatcatgttgacttggcaaaaatacgacgtagaggtagatatt
tggtcagctggttgtatcttcgcagaaatgattgaaggtaaacctttattccctggtaag
gaccatgttcatcagttctctattattacagatttgttaggttcccctcctagtgatgtg
atcaacactatctgttctgaaaatacccttaaatttgtgacatctttgcctcacagagat
ccagttcctttctcagaaagatttaaagcagttgaacctgaggcggtagacttattagag
aaaatgttggtatttgatccaaagaaaagaattacagctgccgatgtattggtccatcca
tatttgtcaccttatcatgatccaactgatgaaccagtagcagaagccaaattcgactgg
cattttaatgacgctgatttaccagtagatacatggcgtgtaatgatgtattctgaaatt
ttagatttccataaaattggtggaactgacggccaaatcgatacaagtgccacttttgat
gatcaagttgccgcagcaactgcggctgctgctcaagctcaagctcaagctgaagcccaa
aatcaaaatctaacacagacacaagcatcgttggatgctttgactaacgatccaaatttt
accgctttggatgaaactatatcaaattatggagatcaagctatacaatacgcaaatgaa
ttccaacaacagcattag

DBGET integrated database retrieval system