KEGG   Veillonella parvula: Vpar_0070Help
Entry
Vpar_0070         CDS       T01130                                 

Definition
(GenBank) ATPase associated with various cellular activities AAA_5
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
vpr  Veillonella parvula
Pathway
vpr00860  Porphyrin and chlorophyll metabolism
vpr01100  Metabolic pathways
vpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Vpar_0070
Enzymes [BR:vpr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Vpar_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Mg_chelatase Sigma54_activat MCM AAA_3 AAA_16 AAA Asp_Glu_race AAA_29
Motif
Other DBs
NCBI-ProteinID: ACZ23759
JGI: Vpar_0070
UniProt: D1BQE6
Position
127240..128169
Genome map
AA seq 309 aa AA seqDB search
MLYPFTAIVGQDEMKLALLLNAINPSIGGVLIEGEKGTAKSTAVRALPSLLPPMETGTDA
MTVVELPINATEDRVVGSINLEKALQEGVKAFEPGILHAAHQNILYVDEVNLLDDHIVDI
LLDVAAMGVNTVEREGVSHSHPSRFILVGTMNPEEGDLRPQLLDRFGLSVMVYGEQDPAQ
RMEVIKRRLAFGDAPEAFIASYEESEQALHERLLQARKLLPTIIPSDDSLLKIASISIGV
GVDGHRSDITMMHTARAHAAFHGRSQIIDDDIKVAARLTLKHRMRRLPFEEQGHDEDRID
TAVSAVIEG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgttatatccatttactgctattgttggtcaagatgaaatgaaattggctcttttgcta
aatgccatcaatccgtccattggcggtgtgttaattgagggcgaaaagggcactgcaaag
tctacggctgtacgtgcattgccaagcctgttacctccgatggaaacagggactgatgcg
atgaccgtagtagaattacctataaatgctacggaagaccgcgttgtagggtctattaat
ttagaaaaggcattgcaagagggggtaaaagcttttgaaccggggattttacacgcagca
catcaaaatattctctatgtagatgaggtgaatctattagatgaccatattgtagatatt
ttgctagacgtggccgctatgggggtaaatacggtagagcgagaaggggtaagccattct
catccatctcgcttcatcctcgtcggaactatgaaccctgaagagggggacctaagacct
cagctattagatcgctttgggttgtccgtcatggtctatggtgaacaggatccagcccag
cggatggaggtgattaagcgacgtcttgcatttggcgatgctccagaagcgtttatagcg
tcttatgaggaatcggagcaagcattacatgagcgcttgctacaagctcgcaaattattg
ccaaccattattccctccgatgatagtttgcttaagatagcaagcattagtatcggcgtt
ggcgttgatggccatcgttcagatattacgatgatgcacaccgctcgcgctcatgcagcc
tttcacggtcgctcacaaatcatagatgacgacattaaggtggccgcaagattgacgtta
aaacatcgcatgcggagattgccttttgaagaacaaggtcacgacgaagaccgcatcgat
acagcagtatctgcggtaatcgagggctag

DBGET integrated database retrieval system