KEGG   Veillonella parvula: Vpar_0070Help
Entry
Vpar_0070         CDS       T01130                                 

Definition
ATPase AAA
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
vpr  Veillonella parvula
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Vpar_0070
Enzymes [BR:vpr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Vpar_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
127240..128169
Genome map
AA seq 309 aa AA seqDB search
MLYPFTAIVGQDEMKLALLLNAINPSIGGVLIEGEKGTAKSTAVRALPSLLPPMETGTDA
MTVVELPINATEDRVVGSINLEKALQEGVKAFEPGILHAAHQNILYVDEVNLLDDHIVDI
LLDVAAMGVNTVEREGVSHSHPSRFILVGTMNPEEGDLRPQLLDRFGLSVMVYGEQDPAQ
RMEVIKRRLAFGDAPEAFIASYEESEQALHERLLQARKLLPTIIPSDDSLLKIASISIGV
GVDGHRSDITMMHTARAHAAFHGRSQIIDDDIKVAARLTLKHRMRRLPFEEQGHDEDRID
TAVSAVIEG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgttatatccatttactgctattgttggtcaagatgaaatgaaattggctcttttgcta
aatgccatcaatccgtccattggcggtgtgttaattgagggcgaaaagggcactgcaaag
tctacggctgtacgtgcattgccaagcctgttacctccgatggaaacagggactgatgcg
atgaccgtagtagaattacctataaatgctacggaagaccgcgttgtagggtctattaat
ttagaaaaggcattgcaagagggggtaaaagcttttgaaccggggattttacacgcagca
catcaaaatattctctatgtagatgaggtgaatctattagatgaccatattgtagatatt
ttgctagacgtggccgctatgggggtaaatacggtagagcgagaaggggtaagccattct
catccatctcgcttcatcctcgtcggaactatgaaccctgaagagggggacctaagacct
cagctattagatcgctttgggttgtccgtcatggtctatggtgaacaggatccagcccag
cggatggaggtgattaagcgacgtcttgcatttggcgatgctccagaagcgtttatagcg
tcttatgaggaatcggagcaagcattacatgagcgcttgctacaagctcgcaaattattg
ccaaccattattccctccgatgatagtttgcttaagatagcaagcattagtatcggcgtt
ggcgttgatggccatcgttcagatattacgatgatgcacaccgctcgcgctcatgcagcc
tttcacggtcgctcacaaatcatagatgacgacattaaggtggccgcaagattgacgtta
aaacatcgcatgcggagattgccttttgaagaacaaggtcacgacgaagaccgcatcgat
acagcagtatctgcggtaatcgagggctag

DBGET integrated database retrieval system