KEGG   Veillonella parvula: Vpar_0071Help
Entry
Vpar_0071         CDS       T01130                                 

Definition
von Willebrand factor A
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
vpr  Veillonella parvula
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vpr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
128172..130187
Genome map
AA seq 671 aa AA seqDB search
METSVQEALKIGLVNDQIHSIVISGGTGVGKSFMVRQCLDTWHIPYRVIPVYIDNSQLQE
SIDFEASLEQGKMIMASSLLDDDNTRCWLIDDGHVVSPEVRHALLTEAKRRQILLIMTIN
HEDRALTDAEWELVDVHVSMEPASLESRMAVLQQTRDVISCADTVLPSTEEHSFKDVVSL
IDHKRISSIAVPDAMISLAISYALQARTVGYGAEFVLLQVMKSLALLDGVSYCKPIHAER
GALYVLPHRMKRDDTTTSQPSQGENGNSKTDRNQLENRAEHASDQADEDAQYEADQNDSM
GNEAAPKDSNANDGDTHSAMNSAEDASSQQDDSSEADGSNQSNDLDATQKESCDSEAMNV
GGDDSQRLSSLCLPDTVARIANQLFQWKLESSKTVDRQYRKGSGRRLMTKTKDTRGRMIR
AYQDEHALEDLALVDTLRAAAPYQRLRAATKTEQEKLSTQSQQLKHQGGKGLAIVIKPQD
YRRKAREKRIGAYQLFVVDASGSMAARHRMEATKAAILSLLRDSYIHRDSVGLIAFRKES
AEVLLPFTRSVERAERLLTSMPTGGKTPLAHGLRMAYTLCDRLLRAHRAERIQIICITDG
RATSGDSEDPVAESKQWARILGTLPVDCIVIDTETGFIKLGLAKELCKLMNGSYYAMDTI
TADRILRVSRR
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatctgtacaagaggctctcaaaataggccttgtaaacgaccagatacatagc
attgtcatttctgggggaactggtgtcggtaaaagctttatggttcgtcagtgcctcgat
acatggcatattccctatcgtgttataccggtttatatagataactcacaacttcaagaa
agcatcgattttgaagcctctctcgagcaaggtaagatgatcatggcctctagtctatta
gatgacgataatactcgatgctggctcatcgatgatggtcatgtggtatccccagaagtg
cgtcatgccttattaacagaggcaaaacgccgccaaatcttgttgattatgaccataaac
catgaggatagagccttaactgatgcggaatgggaactcgtagatgtacacgtatctatg
gaaccagcttcattggagtctaggatggcggtattacaacaaactcgagatgtaatttct
tgtgcagatactgtgttaccttcaacagaagagcactcatttaaggatgtagtcagttta
atcgatcataagcggatttcatcgattgccgttcctgatgcaatgatttcattagccatt
tcctatgcactccaagctcgtactgtaggttacggtgcagagtttgtattgctccaagtt
atgaaatcactggcgcttcttgatggtgtttcttactgtaagcccattcatgcagagcgg
ggtgctctttatgtactgcctcatcggatgaagcgtgatgacacaaccacatcacagcct
tcacaaggggagaatggaaatagtaaaacggatagaaatcaactagaaaatagggccgaa
catgcatcggaccaagctgatgaagatgcacaatatgaagcggaccaaaacgattctatg
ggcaatgaagcagctcctaaggattcaaacgctaatgatggggacactcattctgctatg
aatagtgcagaagatgcatcttctcagcaagacgattcaagtgaagctgatggttctaat
caatctaacgacttagatgctacacagaaggaatcctgtgattccgaagctatgaacgta
ggtggagacgactcacaacgcttgtcctctttatgtttgcccgatacggttgcccgtata
gctaaccaattattccaatggaaactagaatcctctaaaacagtagaccgtcagtatcgc
aagggctccggccgtcgcctcatgaccaaaacaaaggacacgagagggcgtatgattcga
gcttaccaagatgaacatgccttagaggacttggcgctagtagatacgttgcgtgcagca
gcaccctaccaacgattgcgggctgctactaaaacggaacaagaaaaactatctactcag
tcccagcaattaaagcatcaaggcggcaagggattagctatagtgataaaacctcaggat
tatcgccgaaaagcccgtgaaaagcgcattggtgcatatcaacttttcgtggtagatgcc
agtggatctatggcggcgcgtcatcgcatggaggccacaaaagcggctattctaagtctc
ttgcgagattcttatatccaccgtgattcggtagggctcattgcgttccgcaaggagtcg
gcagaggtgttattgcctttcacgcgcagcgttgagcgagcagagcgattgttaacctct
atgcctacaggcggtaaaacgccgttagctcacggtttacggatggcctataccctgtgc
gatagattgttacgtgcccatcgggcggaacgaattcagattatatgtatcaccgatggt
cgagctacgtcgggtgattctgaagaccctgtagccgagtccaagcaatgggctcgtatc
cttggtactttgcctgtagattgtattgttatcgatacggaaacgggctttatcaaactt
ggattggctaaggaattatgtaaattgatgaatggcagttattatgccatggatactatt
acggcagatcgtattttgcgagtgtctcggaggtag

DBGET integrated database retrieval system