KEGG   Veillonella parvula: Vpar_0109Help
Entry
Vpar_0109         CDS       T01130                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vpr  Veillonella parvula
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Vpar_0109
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Vpar_0109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(171250..172137)
Genome map
AA seq 295 aa AA seqDB search
MNRIVVIGSCNMDIIVLADKRPTAGETIMGNELHIAHGGKGANQAVAAARLGAEVTMVGC
IGEDAYGQMILDNLKENFINTDYIVTVPNTTTGTAHITLAEGDNSIIVIAGANAKVDKSI
VDNAWAAIEQADLVMVQNEIPIPTIEYIVRRCHEANVKVLLNPAPAADLDSEWLKLATYI
TPNEHELSALYPNQSTEETLLANENKIIVTLGSKGVGYADNGEIHIVPGFKVEPVDTTGA
GDTFNGAFATAIVNGKSLADALHYGNAAAALSIQRLGAQGGMPTKDEVAAFLAKN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtattgttgttattggcagttgcaacatggatattatagtcctcgcggataaa
cgccctactgcgggcgaaacaattatgggcaacgaattgcacatcgcgcacggtggcaag
ggtgcaaaccaagcggtggctgcggctcgtctaggtgcagaggtcacgatggtcggctgt
atcggtgaagatgcatacggccaaatgattttagataatttaaaagaaaatttcatcaat
acagattacatcgttacggtaccgaacactacaaccggtacagcacacattacattagcg
gaaggcgataacagtatcatcgtgattgcaggtgctaacgctaaggtcgacaaatccata
gttgataacgcttgggctgccattgagcaagccgatcttgtaatggttcaaaacgagatt
cctattccaactattgaatacatcgttcgtcgttgtcacgaggcgaatgtgaaagtcctc
ttaaatcctgctccagcagccgacctcgattcggaatggttaaaattagcaacctatatt
acgccaaacgaacatgagctatctgcgctctaccctaaccaatctactgaggaaaccttg
ctggcgaacgaaaacaaaatcatcgttacccttggtagcaagggcgtaggatatgcggac
aacggtgaaatccacatcgtacctggcttcaaggttgagcccgtagatacaacaggcgct
ggcgatacttttaacggcgcctttgcaacggctattgttaatggtaaaagcttagccgac
gctctacactacggtaatgcagcagcggccctctccatccaacgcttgggagctcaaggc
ggcatgccaacaaaggacgaggttgctgcattcttggcaaagaattag

DBGET integrated database retrieval system