KEGG   Veillonella parvula: Vpar_0162Help
Entry
Vpar_0162         CDS       T01130                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vpr  Veillonella parvula
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vpar_0162
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vpar_0162
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vpar_0162
Enzymes [BR:vpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vpar_0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
229950..231143
Genome map
AA seq 397 aa AA seqDB search
MSEQRHGYFGSFGGQFMPETLMNAVIELEEAYNKYKDDPDFVHELEDLHKKYTGRPSLLY
YADRMTKDLGGAKIYLKREDLNHTGSHKLNNVIGQMLLAKRMGKTRVIAETGAGQHGVAT
ATIAALMGMECEVYMGAEDCERQALNVYRMELLGAKVHPVTTGTSTLKDAVSEALREWTN
RMSDTHYVLGSVMGAHPFPMIVRDFQSIISREAREQILEVEGKLPTAVMACVGGGSNAMG
MFYHFIPDEGVRLIGCEAAGRGIDTEEHAATIAKGSVGIFHGMKSYFCQDEDGQIAPVYS
ISAGLDYPGIGPEHAYLHDSGRAEYVPVTDDEAVDAFEYLSRLEGIIPAIESAHAVAHAR
KIAPTMSKDDIIIICLSGRGDKDVAAMAKYRGVDLHE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaaagacatggctattttggctcctttggggggcaatttatgccagaaaca
ttgatgaatgcagtcatcgaactagaagaggcgtacaacaagtacaaagatgatcctgat
ttcgtacatgaacttgaggatttacataaaaaatatacaggtcgcccatctcttttatac
tatgcggaccgtatgacaaaggaccttgggggagccaaaatttatttaaaacgtgaggac
ttaaaccatactggttctcacaagttgaataatgtaatcggtcaaatgttattggcaaaa
cggatgggtaaaactcgtgttattgctgaaactggggcaggtcaacacggcgtggcaacg
gctactattgctgcgctgatgggtatggaatgcgaagtatacatgggtgcagaggactgt
gaacgtcaagcacttaacgtatatcgtatggaattgctaggcgctaaggtgcatccagta
acaacagggactagtacattgaaagatgcggtttccgaagcgttgcgcgaatggacaaac
cgcatgtcagatacgcactatgtattgggctctgttatgggggctcatccattccctatg
atcgtacgcgatttccaatccattatcagccgtgaagcgcgtgaacaaatccttgaagta
gaaggcaaattgccaacagctgttatggcttgtgtaggtggcggctctaatgcgatgggc
atgttctatcactttattccagatgaaggggttcgtctcatcggttgtgaagcagcaggt
cgcggcatcgatactgaggaacatgcggcaacaatcgcgaaggggtctgttggtatcttc
catggcatgaaatcctacttctgccaagatgaagacggtcaaattgctccagtatattct
atttctgcaggtctcgattaccctggcatcggtcctgaacatgcgtacttgcacgatagc
ggtcgtgctgaatatgtgcctgttacagatgacgaagcagtagatgcctttgaatattta
tctcgcttggaaggtattattcctgcgattgaaagtgctcatgcggtggcacatgcacgt
aaaattgctcctactatgagcaaggacgacatcattattatttgtttatctggtcgcggt
gacaaagacgtagcggctatggcgaaatatagaggggtggatcttcatgagtaa

DBGET integrated database retrieval system