KEGG   Veillonella parvula: Vpar_0162Help
Entry
Vpar_0162         CDS       T01130                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vpr  Veillonella parvula
Pathway
vpr00260  Glycine, serine and threonine metabolism
vpr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vpr01100  Metabolic pathways
vpr01110  Biosynthesis of secondary metabolites
vpr01130  Biosynthesis of antibiotics
vpr01230  Biosynthesis of amino acids
Module
vpr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vpar_0162
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vpar_0162
Enzymes [BR:vpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vpar_0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACZ23850
JGI: Vpar_0162
UniProt: D1BQN7
Position
229950..231143
Genome map
AA seq 397 aa AA seqDB search
MSEQRHGYFGSFGGQFMPETLMNAVIELEEAYNKYKDDPDFVHELEDLHKKYTGRPSLLY
YADRMTKDLGGAKIYLKREDLNHTGSHKLNNVIGQMLLAKRMGKTRVIAETGAGQHGVAT
ATIAALMGMECEVYMGAEDCERQALNVYRMELLGAKVHPVTTGTSTLKDAVSEALREWTN
RMSDTHYVLGSVMGAHPFPMIVRDFQSIISREAREQILEVEGKLPTAVMACVGGGSNAMG
MFYHFIPDEGVRLIGCEAAGRGIDTEEHAATIAKGSVGIFHGMKSYFCQDEDGQIAPVYS
ISAGLDYPGIGPEHAYLHDSGRAEYVPVTDDEAVDAFEYLSRLEGIIPAIESAHAVAHAR
KIAPTMSKDDIIIICLSGRGDKDVAAMAKYRGVDLHE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaaagacatggctattttggctcctttggggggcaatttatgccagaaaca
ttgatgaatgcagtcatcgaactagaagaggcgtacaacaagtacaaagatgatcctgat
ttcgtacatgaacttgaggatttacataaaaaatatacaggtcgcccatctcttttatac
tatgcggaccgtatgacaaaggaccttgggggagccaaaatttatttaaaacgtgaggac
ttaaaccatactggttctcacaagttgaataatgtaatcggtcaaatgttattggcaaaa
cggatgggtaaaactcgtgttattgctgaaactggggcaggtcaacacggcgtggcaacg
gctactattgctgcgctgatgggtatggaatgcgaagtatacatgggtgcagaggactgt
gaacgtcaagcacttaacgtatatcgtatggaattgctaggcgctaaggtgcatccagta
acaacagggactagtacattgaaagatgcggtttccgaagcgttgcgcgaatggacaaac
cgcatgtcagatacgcactatgtattgggctctgttatgggggctcatccattccctatg
atcgtacgcgatttccaatccattatcagccgtgaagcgcgtgaacaaatccttgaagta
gaaggcaaattgccaacagctgttatggcttgtgtaggtggcggctctaatgcgatgggc
atgttctatcactttattccagatgaaggggttcgtctcatcggttgtgaagcagcaggt
cgcggcatcgatactgaggaacatgcggcaacaatcgcgaaggggtctgttggtatcttc
catggcatgaaatcctacttctgccaagatgaagacggtcaaattgctccagtatattct
atttctgcaggtctcgattaccctggcatcggtcctgaacatgcgtacttgcacgatagc
ggtcgtgctgaatatgtgcctgttacagatgacgaagcagtagatgcctttgaatattta
tctcgcttggaaggtattattcctgcgattgaaagtgctcatgcggtggcacatgcacgt
aaaattgctcctactatgagcaaggacgacatcattattatttgtttatctggtcgcggt
gacaaagacgtagcggctatggcgaaatatagaggggtggatcttcatgagtaa

DBGET integrated database retrieval system