KEGG   Veillonella parvula: Vpar_0163Help
Entry
Vpar_0163         CDS       T01130                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vpr  Veillonella parvula
Pathway
vpr00260  Glycine, serine and threonine metabolism
vpr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vpr01100  Metabolic pathways
vpr01110  Biosynthesis of secondary metabolites
vpr01130  Biosynthesis of antibiotics
vpr01230  Biosynthesis of amino acids
Module
vpr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vpar_0163
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vpar_0163
Enzymes [BR:vpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vpar_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ACZ23851
JGI: Vpar_0163
UniProt: D1BQN8
Position
231136..231927
Genome map
AA seq 263 aa AA seqDB search
MSKIKDAFTKGKAFIPFISAGDHGIENTERYIRIMVKAGADMVEIGIPFSDPTAEGPVIQ
EASTRALSTGVKINDIFDMVRCLRTGEEAVTVPLVFMTYLNPIYVFGREKFFTLCEEVGI
SGVIVPDMPFEEKGELASVAHKHGVEVVSLIAPTSENRIEMIAKDAEGFVYCVSSLGVTG
MRSEIKTDIKSIVETIRKYTDIPVAVGFGISKPEQAETMARVSDGAIVGSAIVKIVAEHG
EHADQALFDYVQSMKQAVLKAGA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattaaagacgctttcacaaagggcaaggcattcatcccgttcattagtgca
ggtgaccacggtattgaaaatacagaacgttatattcgcattatggtaaaagccggtgca
gacatggtggaaatcggtattcctttctccgatcccacagcggaaggcccagttatccaa
gaagcaagtacacgcgcattatctacaggcgtaaaaatcaatgatatcttcgatatggtg
cgttgtttgcgcacaggtgaagaagcagtaaccgtgccactcgtgttcatgacctattta
aatccaatctacgtattcggtcgtgaaaaattctttaccctctgtgaagaggtgggaatt
tctggtgttatcgtgccagacatgccgtttgaagaaaaaggcgagctcgctagtgtggcc
cataaacatggtgttgaagtggtatccttaattgcgccaacatctgaaaaccgcatcgaa
atgatcgcaaaagacgcagaaggctttgtatactgcgtatcctcacttggcgttacaggc
atgcgcagtgaaattaagacggatattaaatccatcgttgaaaccattcgcaaatataca
gatatccctgtagctgttggttttggtatttctaagccagaacaagcggaaactatggcg
cgcgtatccgatggagccatcgtaggctctgccatcgttaaaatcgtggcagaacacggt
gaacatgcggatcaagcgttgtttgattacgtacaatccatgaaacaagctgttctaaag
gctggcgcataa

DBGET integrated database retrieval system