KEGG   Veillonella parvula: Vpar_0163Help
Entry
Vpar_0163         CDS       T01130                                 

Definition
TspO and MBR-like proteins
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vpr  Veillonella parvula
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vpr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:vpr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:vpr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
231136..231927
Genome map
AA seq 263 aa AA seqDB search
MSKIKDAFTKGKAFIPFISAGDHGIENTERYIRIMVKAGADMVEIGIPFSDPTAEGPVIQ
EASTRALSTGVKINDIFDMVRCLRTGEEAVTVPLVFMTYLNPIYVFGREKFFTLCEEVGI
SGVIVPDMPFEEKGELASVAHKHGVEVVSLIAPTSENRIEMIAKDAEGFVYCVSSLGVTG
MRSEIKTDIKSIVETIRKYTDIPVAVGFGISKPEQAETMARVSDGAIVGSAIVKIVAEHG
EHADQALFDYVQSMKQAVLKAGA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattaaagacgctttcacaaagggcaaggcattcatcccgttcattagtgca
ggtgaccacggtattgaaaatacagaacgttatattcgcattatggtaaaagccggtgca
gacatggtggaaatcggtattcctttctccgatcccacagcggaaggcccagttatccaa
gaagcaagtacacgcgcattatctacaggcgtaaaaatcaatgatatcttcgatatggtg
cgttgtttgcgcacaggtgaagaagcagtaaccgtgccactcgtgttcatgacctattta
aatccaatctacgtattcggtcgtgaaaaattctttaccctctgtgaagaggtgggaatt
tctggtgttatcgtgccagacatgccgtttgaagaaaaaggcgagctcgctagtgtggcc
cataaacatggtgttgaagtggtatccttaattgcgccaacatctgaaaaccgcatcgaa
atgatcgcaaaagacgcagaaggctttgtatactgcgtatcctcacttggcgttacaggc
atgcgcagtgaaattaagacggatattaaatccatcgttgaaaccattcgcaaatataca
gatatccctgtagctgttggttttggtatttctaagccagaacaagcggaaactatggcg
cgcgtatccgatggagccatcgtaggctctgccatcgttaaaatcgtggcagaacacggt
gaacatgcggatcaagcgttgtttgattacgtacaatccatgaaacaagctgttctaaag
gctggcgcataa

DBGET integrated database retrieval system