KEGG   Veillonella parvula: Vpar_0163Help
Entry
Vpar_0163         CDS       T01130                                 

Definition
TspO and MBR-like proteins
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vpr  Veillonella parvula
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vpar_0163
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vpar_0163
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vpar_0163
Enzymes [BR:vpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vpar_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
231136..231927
Genome map
AA seq 263 aa AA seqDB search
MSKIKDAFTKGKAFIPFISAGDHGIENTERYIRIMVKAGADMVEIGIPFSDPTAEGPVIQ
EASTRALSTGVKINDIFDMVRCLRTGEEAVTVPLVFMTYLNPIYVFGREKFFTLCEEVGI
SGVIVPDMPFEEKGELASVAHKHGVEVVSLIAPTSENRIEMIAKDAEGFVYCVSSLGVTG
MRSEIKTDIKSIVETIRKYTDIPVAVGFGISKPEQAETMARVSDGAIVGSAIVKIVAEHG
EHADQALFDYVQSMKQAVLKAGA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattaaagacgctttcacaaagggcaaggcattcatcccgttcattagtgca
ggtgaccacggtattgaaaatacagaacgttatattcgcattatggtaaaagccggtgca
gacatggtggaaatcggtattcctttctccgatcccacagcggaaggcccagttatccaa
gaagcaagtacacgcgcattatctacaggcgtaaaaatcaatgatatcttcgatatggtg
cgttgtttgcgcacaggtgaagaagcagtaaccgtgccactcgtgttcatgacctattta
aatccaatctacgtattcggtcgtgaaaaattctttaccctctgtgaagaggtgggaatt
tctggtgttatcgtgccagacatgccgtttgaagaaaaaggcgagctcgctagtgtggcc
cataaacatggtgttgaagtggtatccttaattgcgccaacatctgaaaaccgcatcgaa
atgatcgcaaaagacgcagaaggctttgtatactgcgtatcctcacttggcgttacaggc
atgcgcagtgaaattaagacggatattaaatccatcgttgaaaccattcgcaaatataca
gatatccctgtagctgttggttttggtatttctaagccagaacaagcggaaactatggcg
cgcgtatccgatggagccatcgtaggctctgccatcgttaaaatcgtggcagaacacggt
gaacatgcggatcaagcgttgtttgattacgtacaatccatgaaacaagctgttctaaag
gctggcgcataa

DBGET integrated database retrieval system