KEGG   Veillonella parvula: Vpar_0163Help
Entry
Vpar_0163         CDS       T01130                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vpr  Veillonella parvula
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vpar_0163
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vpar_0163
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vpar_0163
Enzymes [BR:vpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vpar_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
231136..231927
Genome map
AA seq 263 aa AA seqDB search
MSKIKDAFTKGKAFIPFISAGDHGIENTERYIRIMVKAGADMVEIGIPFSDPTAEGPVIQ
EASTRALSTGVKINDIFDMVRCLRTGEEAVTVPLVFMTYLNPIYVFGREKFFTLCEEVGI
SGVIVPDMPFEEKGELASVAHKHGVEVVSLIAPTSENRIEMIAKDAEGFVYCVSSLGVTG
MRSEIKTDIKSIVETIRKYTDIPVAVGFGISKPEQAETMARVSDGAIVGSAIVKIVAEHG
EHADQALFDYVQSMKQAVLKAGA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattaaagacgctttcacaaagggcaaggcattcatcccgttcattagtgca
ggtgaccacggtattgaaaatacagaacgttatattcgcattatggtaaaagccggtgca
gacatggtggaaatcggtattcctttctccgatcccacagcggaaggcccagttatccaa
gaagcaagtacacgcgcattatctacaggcgtaaaaatcaatgatatcttcgatatggtg
cgttgtttgcgcacaggtgaagaagcagtaaccgtgccactcgtgttcatgacctattta
aatccaatctacgtattcggtcgtgaaaaattctttaccctctgtgaagaggtgggaatt
tctggtgttatcgtgccagacatgccgtttgaagaaaaaggcgagctcgctagtgtggcc
cataaacatggtgttgaagtggtatccttaattgcgccaacatctgaaaaccgcatcgaa
atgatcgcaaaagacgcagaaggctttgtatactgcgtatcctcacttggcgttacaggc
atgcgcagtgaaattaagacggatattaaatccatcgttgaaaccattcgcaaatataca
gatatccctgtagctgttggttttggtatttctaagccagaacaagcggaaactatggcg
cgcgtatccgatggagccatcgtaggctctgccatcgttaaaatcgtggcagaacacggt
gaacatgcggatcaagcgttgtttgattacgtacaatccatgaaacaagctgttctaaag
gctggcgcataa

DBGET integrated database retrieval system