KEGG   Veillonella parvula: Vpar_0218Help
Entry
Vpar_0218         CDS       T01130                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
vpr  Veillonella parvula
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Vpar_0218
Enzymes [BR:vpr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Vpar_0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
292739..294355
Genome map
AA seq 538 aa AA seqDB search
MNVTIVGGGLTGLTAAYYLGHAKPEWTITLFEQAPRFGGKIQTQRVDDFVVELGPDSYLG
RKTEMTDLVHDLGLGDTLVSNETGQAFVYDKGSIHPIPGGSIMGIPTEMMPFVKATLISW
PGKLRAGLDYFKKPYQLDENGDVSIGHFFKYHLGQEMMDKLIEPLLAGIYGGDIYKISLL
STFPHFIQVEQKYGNMVKGMMAAKMSHSKAGVSKAAKGAVTEGDVPRAGKGTMTDRQFES
HEAKTSQDSAASNSVNGSSHVTKTSSNHQSAKAQADMESRKGTAAQSGMFRQLTGGLESV
ITAIVEAMPSNVQLYTGALVSDIRYVDGVYAIDVAKSCNDSCGCQSTAEHVIISTPPATY
TQWFKDDAGFDFLRSMEQSSCAIAIMSFDKSNFDGDLKGSGLLITRNTNTPLTACTILNQ
KWPQTTPDDKVVLRVFIGKPGNDVVERLSEEELSELAVKEIQHIMGFSVKPEWVRINRLI
HCMPQYNVGHRAGIKAVREHVAEHYPNLHLIGTPFDGIGIPDGVKQAKELVEKLVNDK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtaacaattgtgggcggtggcttaacagggctaacagcggcttattatttaggc
catgcaaagccggaatggaccattactcttttcgaacaagcaccacgatttggtgggaaa
atacaaacgcaacgtgtggatgacttcgtagtggaactcggtcctgactcctatttgggg
cgtaaaacagaaatgacagatctcgtgcatgatcttggactaggtgatacccttgtgtct
aatgaaacaggtcaagcctttgtatatgataagggctctatccacccaattccgggcggc
tccatcatgggcattcctacggaaatgatgccctttgtgaaagcaacactcatttcatgg
cctggtaaattgcgtgctggcctagattattttaagaaaccataccaactcgatgaaaat
ggggatgtatccattggtcatttcttcaaataccacttaggacaagaaatgatggataaa
ctcatcgagcccctattagctggcatctatggtggcgatatttataaaattagcctattg
tcgacattccctcattttattcaagtagaacaaaaatatggaaacatggtaaaaggtatg
atggctgctaagatgagtcactccaaagcgggtgtctctaaggccgccaaaggggctgtt
actgaaggtgatgtgcctcgagctggtaaaggaaccatgacggaccgtcaatttgaaagt
cacgaagctaagactagtcaagatagtgctgctagtaatagtgtaaacggctctagccat
gtgacaaagactagttctaatcatcagtctgcaaaggcgcaagcggatatggaaagtaga
aagggtactgctgctcaatctggtatgttccgtcaattgacaggcggccttgaaagcgtt
attaccgctatcgttgaggccatgcctagtaatgtacagttgtatacaggtgcactagtt
tctgatattcggtatgttgatggtgtatatgcaatagatgtagcgaagtcgtgtaacgat
tcttgtggctgtcaatctacggcagaacatgtgattatcagtacgccgccggcaacatat
actcaatggttcaaggatgatgcgggttttgatttcttgcgttccatggagcaatctagt
tgcgccattgctatcatgtcttttgataaaagcaactttgatggtgatttaaagggatca
ggtcttctcattactcgtaacacgaatacacctctcacagcgtgtaccattcttaatcaa
aaatggccacaaactacgcctgatgataaggtagtgttgcgcgtcttcatcggtaagcct
ggtaatgatgtggtagaacgactcagcgaagaggaactttcagaattggcagttaaagaa
attcaacatatcatgggtttttctgtcaaacctgaatgggtacgtatcaatcgtctcatt
cactgcatgccgcaatataatgtaggccatcgtgcagggattaaagcagtccgtgaacat
gtggcggaacattatccaaatttacacctcatcggtacgccatttgatggcattggtatt
cctgatggtgtaaaacaagcaaaagaactcgtagaaaaacttgtgaatgacaagtaa

DBGET integrated database retrieval system