KEGG   Veillonella parvula: Vpar_0449Help
Entry
Vpar_0449         CDS       T01130                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
vpr  Veillonella parvula
Brite
Enzymes [BR:vpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Vpar_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
535745..538699
Genome map
AA seq 984 aa AA seqDB search
MEIKLAVLPHQTKCVKSIASVFDSVNMVETDEPSANPIFSKEDITLKNNIDKIQSGLYES
VIPVESRTSIANEFGVDIKMETGTGKTYCYTRLMYELNKLYGFFKFIILVPTTPIKEGTL
NFIQSNYAMQHFSDLYPGRRIELSVLNVQKSNKGRKMFPQAVANFARSTVLEKNKISALL
MTSGMLISKTTMDTDYDQTLLGHYSKPYDTLKATRPIVIIDEPHKFKRENTAYKRLIERI
DPLCIIRFGATFPKKRGQQERDYNNLLFNLGACEAFNSNLVKGVETQLIEQESLNETRVK
VLDIKHTNPKSCVIRNEKSGKSYTLALNDSLSTVSDDFHGVIIQSIGKTEEETIKNGITL
SNGQILAKGDQIYAGVYSNTYQELMLKQAIQNHIEQERNNFFRETKIKTLSLFFIDSIES
YRGDDGIGPLRCKFQALLEDSLEREYKRYVESTNPIEIEYCDFLKTSLLDIAQTNGGYFA
EDNSTSDIDIQKEIEQILKDKQSLLSFKDEYGRWNTRRFIFSKWTLREGWDNPNVFQICK
LRSSGSEISKLQEVGRGLRLPVDEYGNRLSEEQFYLTYLCDYSEKGFAESLVTEINSDSF
QKSISIMELLPKVAADKGITPNVLMAELLSKCYINCNGEIFEEKAEKFLEEYPEFNIGLI
QGKVRNKNKDNKGHVGIRSNKFDEIKNLWKSLNKKYYLVLDDISDEYLDKAILSILKSGI
KESVYAYTVRKSLVFDKMQAYVRDEPTKSQVLDQSIKYGEFLKQVHQNTGVPIISMHKAL
CLYNKTNPLDDTFFNKRTLSKFIELFQEWFEKAFLKRFSYKPLGIEKRETALTNYNGEVK
NEIAQGVVGIIRDNQMKVPDNFLYDQVVFDSPKEKENIQKSDIDEVVVFGKIPRKSIQVP
LYFGGTTSPDFMYVIKKDSGYEVNLIVETKDIDRTTTLRGTEGLKIESAKKFFDALKESG
VNVVFKAQLKNNDIVPMIKGLQEN
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaattagctgttttacctcatcaaacaaagtgtgttaaaagtattgctagt
gtttttgattcagtgaatatggtagagacggatgagccttctgcaaatcctatttttagt
aaagaggatataacacttaaaaataatatagataaaattcaatcaggcttatatgagtct
gttataccggttgagtctagaactagtattgcaaatgaatttggtgtggatattaaaatg
gagacaggaacaggtaagacttattgttatacaagacttatgtatgaacttaataagcta
tatggttttttcaagtttattattttagttccaacgactcctattaaagaaggaacactc
aattttattcagtctaattatgctatgcagcatttttcagatttatatccaggtagaagg
atagagttatcagtattaaatgtacagaagtcaaataaaggccgtaaaatgtttcctcaa
gcagtggcaaattttgctagatctactgttcttgagaaaaataaaatcagtgcgttatta
atgactagtggaatgcttatatctaaaacaacaatggatacagattatgatcaaacttta
ttaggtcattattcaaaaccttatgatacattaaaagctactagacctattgtgattata
gatgaaccccataaattcaagcgtgaaaatacagcttataagaggctgatagagcgaatt
gacccgttatgtataatccgctttggtgcaacttttcccaaaaaaaggggacaacaagaa
agagattataataatttgctttttaatcttggtgcttgtgaagcattcaatagtaatctt
gttaaaggtgttgaaactcaattaattgagcaggaatctttaaatgaaactagagttaag
gttttagatattaaacatactaatcctaagtcttgtgtgattcgaaatgaaaaaagtggt
aaaagttatacattagctttaaatgattctttgtcaactgttagtgatgactttcatggt
gtaataattcaatcaattggtaaaacagaggaagaaactataaaaaatggaattacatta
tcaaatggtcaaattctagctaaaggggatcaaatatatgctggtgtatacagtaataca
taccaggaattaatgctaaaacaagcgattcaaaatcatattgaacaggagagaaataat
ttttttagagaaacgaaaatcaagaccttatcactattctttattgattcaattgaatcc
tatcgtggggatgatggtataggcccgttacgttgtaagtttcaagcgttattagaagat
tcattagagcgagagtataaaagatatgtagagtctactaatccgatagaaatagaatat
tgtgattttttaaaaacatcattgcttgatattgcacaaactaatggtggttattttgca
gaggacaattctactagtgatattgatatacaaaaagaaattgaacaaattttaaaagac
aagcaatcattattaagttttaaagatgagtatggtcggtggaatacgcggagatttatt
ttctctaaatggacacttagagaaggttgggataatcctaatgttttccaaatctgtaaa
ttgcgttctagtggttcggaaattagtaaactacaagaagttggtcgtggattacgcttg
ccggtagatgaatatggcaatcgtttgtctgaggaacagttttatttaacgtatctttgt
gattattctgaaaagggatttgcagaatctttagttacggagattaatagtgactctttt
caaaaatccatttcaattatggagctattacctaaagtcgctgctgataaggggataact
cccaatgtactaatggctgaattattatctaaatgctatattaattgtaatggtgagatt
tttgaagaaaaagcagaaaaattcttagaggagtatccggaatttaatataggtttaatt
caaggaaaagttagaaataaaaataaagataataaaggtcatgttggaattcgctctaat
aaatttgatgaaattaaaaatctttggaaaagtttaaacaaaaaatattatttagtctta
gatgatatttcagatgaatatttggataaagctatattgtctattcttaaaagtggaatt
aaagaatctgtttatgcttatacggttagaaaaagtcttgtatttgataaaatgcaggca
tatgttcgtgatgaacctactaaatctcaagttcttgaccagagcattaaatatggagaa
tttttaaagcaagttcatcagaatacaggcgtacctattatatccatgcataaagctttg
tgcttatataataagactaatcctttagatgatacattctttaacaagagaacattatca
aagtttatcgaactatttcaagaatggtttgaaaaagccttcttgaaaagattttcttat
aaacctttaggaatagaaaaacgagagacagctttaacaaattataatggtgaggttaag
aatgaaatagcacaaggcgttgttgggattatccgtgataatcaaatgaaggtacctgat
aattttttgtatgatcaagttgtatttgatagtcctaaagagaaagaaaatattcaaaaa
agtgatatcgatgaagtggttgtatttgggaagataccgagaaaaagtattcaagttccg
ctttattttggtggtactacaagtcctgactttatgtatgtaataaaaaaagattctggt
tatgaagtaaatcttatagtagaaaccaaagatattgatcgcaccactactttaaggggc
acagaggggcttaaaattgaatctgctaaaaagttttttgatgctttaaaagaatcaggt
gttaatgttgtttttaaagcgcaattaaaaaataatgatattgtgccaatgataaaaggg
ctacaggaaaattag

DBGET integrated database retrieval system