KEGG   Veillonella parvula: Vpar_0493Help
Entry
Vpar_0493         CDS       T01130                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vpr  Veillonella parvula
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Vpar_0493
Enzymes [BR:vpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Vpar_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
606990..607559
Genome map
AA seq 189 aa AA seqDB search
MNQRAKDGIKQFLEALSVDTEAPELEKTPSRVTELYSELFSGVGLDTKAAWGETFSTDYK
GLVAVTGIPFYSMCEHHLLPFFGTVDIVYQPKDGCVAGLSKFQDIVNILSRRPQLQERLA
SELADAIMNDLFAHGVFVRITSTQLCMLIKGTMQQDSKVITLESRGVLAEKGTLRDEALA
MLGGGQVNV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacgtgcaaaggacgggataaagcaattcttagaggctttatctgttgataca
gaggcaccagaattagagaagacaccaagtcgtgtaacagaattatatagtgaattattc
agcggtgtaggattagacacgaaagctgcatggggagagacttttagtacagactataaa
ggtctcgtagcagttacagggattccgttttactccatgtgtgagcatcatttattgcct
ttttttggtaccgtagatatcgtgtaccaacctaaggatggatgtgtggcaggacttagt
aagtttcaagatatcgtgaatatcctcagccgtagaccgcaattacaagagcggttagca
tctgaattagctgatgcgattatgaatgatttatttgctcatggcgtatttgtacgcatt
acatcgactcagttgtgtatgctcatcaaagggaccatgcagcaagattcaaaggttatt
acattagaaagccgaggcgtattagccgaaaagggcacattaagagatgaagcgttggca
atgttaggcggaggacaggtaaatgtttaa

DBGET integrated database retrieval system