KEGG   Veillonella parvula: Vpar_0496Help
Entry
Vpar_0496         CDS       T01130                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridin epyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vpr  Veillonella parvula
Pathway
vpr00790  Folate biosynthesis
vpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Vpar_0496
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Vpar_0496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ACZ24179
JGI: Vpar_0496
UniProt: D1BLC2
Position
608747..609217
Genome map
AA seq 156 aa AA seqDB search
MYTYYISVGSNIGDKSDYINSAFQSLQQHGAISKLVTSSLIETEPWGYTEQDTFVNGVWS
CESTLEPHQMLSLIQQLEQAAGRKRLIHWGPRTLDLDIILVYDTEGKMISLCDESLVIPH
PHFWNRNFVLEPLSQLLPTFTYKGVKVADRLSQLDV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtatacctattacatcagtgtaggctcaaatataggggacaagagtgactacatcaat
tctgcttttcaatccttacaacaacatggggcaatttctaagctagtcacttcttctctt
attgaaactgagccgtggggatatacggaacaagatacctttgttaatggcgtatggtct
tgtgaaagcactctagaaccacatcaaatgctcagccttattcagcaattagagcaggcg
gctggacgaaaacgattgattcattggggtcctcgcacgttagatttggatattatttta
gtgtacgatacagaggggaaaatgatttctctgtgtgatgaaagtcttgtgataccgcat
cctcatttttggaatcgtaattttgtactagaaccgctatctcagctgttaccaactttc
acatataaaggggttaaggttgccgaccgattatctcaattagatgtataa

DBGET integrated database retrieval system