KEGG   Veillonella parvula: Vpar_0504Help
Entry
Vpar_0504         CDS       T01130                                 

Definition
ATP-dependent metalloprotease FtsH
Orthology
K03798  
cell division protease FtsH [EC:3.4.24.-]
Organism
vpr  Veillonella parvula
Brite
Enzymes [BR:vpr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     Vpar_0504
Peptidases [BR:vpr01002]
 Metallo Peptidases
  Family M41: FtsH endopeptidase family
   Vpar_0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
614777..616705
Genome map
AA seq 642 aa AA seqDB search
MGRFTKNIVLYLLIIAAFVIAIDAFSGQSANKSELSYTGFIQQVQQKKVESVTITNDHGI
KGKLKNGTEFNSYAPTDETLIKTLQDNGVEITAAPPEQPAWWMSLLGSAIPIIILVVLFF
FIMQQTQGGGGRVMNFGKSRAKLMGEGNVKVSFKDVAGAEEAKQELEEVVEFLKDPGKFT
TIGAKIPKGVLLAGPPGTGKTLLAKAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFT
QAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGANEGIITIAATN
RPDILDPALLRPGRFDRQVIVGRPDLRGREAILKVHARNKPLADDVDLKIIAKKTPGFTG
ADLSNLLNEAALLAARLNKKVITMAEVEEASEKVSMGPERRSHIVSDKDRKLTAYHESGH
AIVAHLLPHADPVHKVTIIPRGAAGGYTMMLPTEEQNYKTKSQLLADIRVALGGRIAEAL
ILDEISTGASGDLQSVTNTARAMVTRWGMSDELGPIVFGEQQEQIFLGKNLGHERNYSEE
IAAKIDSEIHRIVEEAYKDVTKLLSDNEKFLHDMANALLEEETIDAKAVDNLYKYGTTKE
PEAEEPKVASEADSSIVPEGVDAKKTTSTVADLSEASSNEIK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
ttgggtcgatttacaaaaaatatcgtcctttatttacttatcattgccgctttcgttatc
gccattgacgctttctctggtcaaagtgcgaataaatctgaactcagttatacaggattt
attcaacaagtacaacagaaaaaggttgagtccgtaacgattaccaatgatcatggtatt
aaaggtaaactaaaaaatggaacagaattcaattcttatgcgccaactgatgaaacgtta
atcaaaactttacaagataatggtgtagaaattactgcagctccacctgagcaaccagct
tggtggatgagcttgttaggttctgctattccaattattattttggttgtattgttcttc
ttcatcatgcaacaaactcaaggtggcggtggccgagtgatgaactttggtaaaagccgt
gctaaattgatgggtgaaggcaatgtaaaggttagcttcaaagatgtagctggcgctgaa
gaagcaaaacaagaattagaagaagtagtagaattcttgaaggatccaggcaagtttaca
actatcggtgctaaaattccgaaaggtgtattattggcagggcctccaggtacaggcaaa
acattacttgctaaagctgttgctggtgaagcaggggtaccattctttacgatttctggt
tctgactttgtagagatgtttgttggtgttggtgcttctcgtgtgcgtgatcttttcaca
caagcgaaaaagaacgctccttgtatcatctttatcgatgaaatcgatgcggttggtcgt
caacgtggcgccggtcttggtggcggtcacgatgaacgtgaacaaacattaaaccaattg
ctcgttgaaatggatggtttcggtgctaacgaaggtattattactatcgctgcaacaaac
cgcccagatattctagatcccgcacttttacgtccagggcgttttgaccgtcaagttatc
gtaggtcgtccagacctacgcggccgtgaagcaatcttgaaagttcatgctcgtaataag
cctttggctgatgatgtagacttgaaaataattgcgaagaaaactccaggctttactggt
gcagacttgagcaatttgttaaatgaagcagctcttttggcggctcgtcttaacaaaaaa
gtaattactatggctgaagttgaagaagccagtgaaaaggttagcatgggtcctgagcgc
cgcagtcacattgtgagcgacaaagatcgcaagttaacagcgtaccatgaatctggtcat
gctattgtggcacatctattgcctcatgcagatcctgttcataaggtaacaattattcct
cgtggtgcagctggtggctacactatgatgcttccaacggaagaacaaaactacaaaaca
aaatctcaattattagcagatattcgggtggctcttggtggtcgaattgcagaagccttg
attttagatgaaatcagtacaggtgcttctggagaccttcaaagtgtaaccaatactgct
cgtgctatggtaactcgttgggggatgagtgatgagcttggccctatcgtgttcggtgaa
caacaagaacaaatcttcttaggaaaaaacctgggccatgagcgcaactatagtgaagaa
atcgctgcgaaaatcgactctgaaattcatcgtatcgtagaagaagcttataaagatgta
acaaaacttcttagcgataatgaaaaattcttacatgacatggcaaatgctttgttagaa
gaggaaacaatcgatgcgaaagcggtagataatctttacaaatatggtacaacaaaagaa
cctgaagctgaggagcctaaagtagcttctgaagcagacagtagcatagtaccagaaggt
gttgatgctaaaaaaacaactagtactgtagcagatcttagtgaagcatcatctaatgaa
attaaataa

DBGET integrated database retrieval system