KEGG   Veillonella parvula: Vpar_0517Help
Entry
Vpar_0517         CDS       T01130                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vpr  Veillonella parvula
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vpr00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vpr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
631051..632316
Genome map
AA seq 421 aa AA seqDB search
MEKLIIQGGNRLEGRVRVSSAKNAVLPIIAGTLLASTSSKLLEIPNLEDVGTICQVIESL
GVKITRNNADGEIVFDASTLTATEAPYELVRKMRASFLVMGPLLARKGEAKISMPGGCAI
GARPIDLHLKAFEALGAKIEITEDYVYAHAPEGLKGTQIYLDFPSVGATENVIMAASMAK
GKTVIENAAEEPEIVDLATFLNAMGANIRGAGTNVIRIEGVPQLHGAIHTVIPDRIEAGT
YLIAAAMAGGDVFVENALPEHLKPVVAKLKEAGVTVEEEIDGIRVISSGKGIKAVDIKTL
PYPGFPTDMQAQFMALTTIAEGTSTVTETVFENRFMHVAELRKMGAHIDIDNRQAIVEGM
PSLHGAIVNATDLRAGAALVCAALTAEGRTEVGRLHHIDRGYDDFVGKLQRLGADIVRVD
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagttaatcattcaaggtggcaatcgattggaaggacgtgtacgtgttagtagt
gctaaaaatgcagtactccctattattgccggtactttgctagcatcaacgtctagtaaa
ttgcttgaaattccaaatttagaagatgtaggcacgatttgccaagttatcgagtctttg
ggagttaaaatcactcgtaataatgcagatggtgaaattgttttcgatgcttctacattg
actgctacggaagctccttatgaacttgtacgtaaaatgcgtgcatccttccttgtcatg
ggtccacttttggctcgtaaaggggaggctaaaatctcaatgcctggtggatgtgctatc
ggtgcacgccccattgatcttcacttaaaagcatttgaagcattaggtgcaaaaattgaa
attactgaagattacgtatatgctcatgcaccggaaggacttaaagggactcaaatttat
ttggatttcccaagtgtgggggctacagagaatgtaattatggctgcttctatggcgaaa
ggtaaaaccgttatcgaaaatgctgcagaagagcctgaaattgttgatttagctacattc
ttaaatgctatgggtgctaatattcgcggagctggtacaaatgtgattcgtattgaaggt
gtacctcaattacacggtgctattcatacagttattcctgaccgcattgaagctggtaca
tatttaatcgcagctgctatggcaggtggtgatgtattcgtagaaaatgcattgccagaa
catctaaaaccagtagtggctaaattaaaggaagctggtgtaacagtagaggaagaaatc
gacggcattcgcgttattagtagtggtaaaggtattaaagctgtcgatattaaaacattg
ccataccctggattcccaacagatatgcaagctcaatttatggctcttactacgattgcg
gaaggcactagtacagtaacagaaactgtatttgaaaatcgttttatgcatgttgctgaa
cttcgtaaaatgggggcgcatattgacatcgacaatcgtcaagctattgtcgaaggtatg
ccaagcttacatggggctatagtgaatgctactgacctgcgtgctggagcggcgcttgta
tgtgctgcattgactgcggaaggtagaacagaagtcggtcgtttacatcatattgaccga
ggttatgatgattttgtaggtaaattgcaaaggttaggtgctgatattgttcgggttgac
gaataa

DBGET integrated database retrieval system