KEGG   Veillonella parvula: Vpar_0563Help
Entry
Vpar_0563         CDS       T01130                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vpr  Veillonella parvula
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Vpar_0563
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Vpar_0563
Enzymes [BR:vpr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Vpar_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
685378..686328
Genome map
AA seq 316 aa AA seqDB search
MGQVSLKGKDLLGLQNVSPEEIKLILDVAKKMKKIVLSDDKKVPLLKGKSIINLFMEPST
RTRSSFELAGKYLGADVINLSPSGSSMGKGESFRDTLLTMSYMGTDAIVMRHSAEGAPLY
ATKAVDPIIINAGDGAHEHPTQALLDMYSILEKKESIEGLKVVILGDIMHSRVARSNIYG
LTKMGADVHLAGPRTMVYPELEKLGVTVHHDIREAVVDADVVNVLRIQLERIHSALYPTN
REYARIFGINNDVLKLAKDDVMVMHPGPMNRGLEIAPDVAYSDQSVIQEQVRNGVAIRMA
VLYLTIIGGDGSELAY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgggacaagttagcctaaaaggcaaagatttattgggtttgcaaaatgtgtcacctgaa
gaaatcaaattgattttagatgtggcaaagaaaatgaagaaaatcgttctttctgatgac
aagaaggttccactattaaagggaaaatccattatcaacctttttatggaaccaagtact
cgtactcgtagttcctttgagttagccggaaaatatttaggggctgacgtaatcaatctt
tctcctagtggatcttccatgggtaaaggtgaaagcttccgcgatacattattaactatg
tcctacatgggtacagatgctatcgtaatgcgccacagcgcagaaggtgcacctttatac
gctacgaaagccgtagatccgattatcattaacgcaggtgatggcgctcatgagcatcca
acacaagcattactagacatgtattctatcttagagaaaaaggaatctattgaaggatta
aaggtggttatccttggcgatataatgcatagtcgcgtagcacgctctaacatttatgga
cttacaaaaatgggggctgatgtacatctggctggtcctcgtacaatggtatatccagaa
cttgaaaaattaggtgttaccgtacaccacgatattcgtgaagccgttgttgatgcagat
gttgtaaacgtacttcgcattcaattagaacgcattcactctgcactatatcctacaaac
agagaatatgcacgtatctttggtattaataacgatgtattgaaattagctaaagacgat
gtaatggtcatgcatccaggtccaatgaaccgtggtctagaaatcgcaccagatgtggcg
tattctgatcaatcagtaattcaagaacaagtgcgtaatggcgtagctatacgtatggct
gtattgtacttaactattatcggaggtgacggtagtgagcttgcttattaa

DBGET integrated database retrieval system