KEGG   Veillonella parvula: Vpar_0648Help
Entry
Vpar_0648         CDS       T01130                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vpr  Veillonella parvula
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Vpar_0648
   00052 Galactose metabolism
    Vpar_0648
   00500 Starch and sucrose metabolism
    Vpar_0648
   00520 Amino sugar and nucleotide sugar metabolism
    Vpar_0648
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Vpar_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
784150..785013
Genome map
AA seq 287 aa AA seqDB search
MQRIRKAVIPAAGFGTRFLPATKAQPKEMLPIVDTPAIQYIVKEALDSGIEEILIITGRN
KRAIEDHFDSSVELELLLQSQGKNKPLAMIKDLADIKVHFIRQKAPRGLGDAVLCAKAFI
GDEPFAVLLGDDIVYNPENPCLKQLIDCYNEHPGIILGAQFVPEDKVSSYGIVSGEALAD
NLYRVDNLVEKPKKEDAPSRLAVLGRYILTPDIFNILEATKPGVGNEVQLTDALAASKTD
TYALAYEGIRYDTGDKLGYLKATVEYALRNEELGESFKAYLKELDLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcattagaaaagctgtaattccagcagctggttttggtacacgtttcttacca
gctaccaaggcacaaccaaaagaaatgcttcctattgtcgatacacctgctatccaatac
attgtaaaagaagctttagattctgggattgaagaaattctaattattacaggtcgtaat
aaacgtgctattgaggaccattttgatagtagtgttgaattagaattgttattacaaagt
caaggtaaaaataaaccattggctatgatcaaggatttggcggacattaaagttcacttt
attcgtcaaaaagcacctcgtggacttggtgatgctgtattgtgtgcaaaagcatttatt
ggtgatgagccatttgcagtgttacttggtgatgatattgtttacaatccagaaaatcca
tgcttaaaacagttgattgattgctataatgagcatcctggtattattttaggcgctcaa
tttgtaccggaagataaagttagttcttatggtattgtatctggtgaagcattggctgat
aatttatatcgcgttgataacttggtggaaaaacctaagaaagaggatgctccatctcga
ctcgctgtattaggtcgttatattttaacaccagatattttcaatatcttagaagctact
aagcctggtgtaggtaatgaagtccaattaactgatgcattggcagcctctaaaacggat
acgtatgcattagcatatgaaggtattcgctacgatacaggggataaattgggctattta
aaagccactgttgagtatgcattgcgcaacgaagaattgggtgaaagctttaaagcttac
ctaaaggaattggatctaaaatag

DBGET integrated database retrieval system