KEGG   Veillonella parvula: Vpar_0792Help
Entry
Vpar_0792         CDS       T01130                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vpr  Veillonella parvula
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Vpar_0792
Enzymes [BR:vpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Vpar_0792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
932649..934802
Genome map
AA seq 717 aa AA seqDB search
MDAIRGFVYRTIYENTQRTYCVFILKDYNEEYITCTGKFESPKEGEDIEVRGRYVEHEKY
GRQFDASSVEKLKPDNMGAAKTYLLNLGIKGFGEKSVEKVLEYFGIRILEILREERPEEI
KDVPGLRKSVKDELFNTLLGEGILSDLNHFFESHHISSKWSRIVYTYYGVQSVAVIEDNP
YTLLRVAPDMLFGTADTLAEHLGINGSDTRRLEAGLEWILRSLDNQGHTCLPVDQLIGRL
DDLLQTDVDDIANFIESLLEQGALYSTYYEDILYIYPPEMYVSEVEGVHYTREFLLQADP
IALDISSFIEKFERDNYITFGDAQKEAIQLSFFEKFSLITGGPGTGKTTIIKALVKGFQL
GGLGRIILCAPTGRAAKRLTEATEFEATTIHRLLVPVQGSDSYDFTKNEDDPLDIDVIII
DEASMLNVRLFYSLMAAIPKEAHVIIVGDVDQLPPIGAGFVLKDLLDSDCVPYTRLNQIY
RQSSGNTIVESAYAINRGEMPNLEGVSEEFSFIPVKSYDMMMKAIIDVYKREQETIEDEL
DIQIISPMRRGEAGSTLISQYVQQAVNPPDSYKGEVRVNGITYRVGDKVIQILNDYELEV
FNGEIGVIYAITRTDICIRFIHKEVRLPIDEAHMIMPAYAITVHKSQGSEYGVVIIPFVP
RYGGMLQRNLLYTAVTRAKRKVIIVGTTSAVERAVRTVNADERYTLFKERLQGRCDS
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatacgaggatttgtataccgaactatatatgagaatacacaacgtacatat
tgcgtgtttatcctaaaagattataatgaggaatacattacttgtactggcaaatttgag
tctcctaaagaaggggaagacatcgaagtacggggccgctatgtagaacatgaaaagtac
ggccgccaatttgatgcgagcagtgttgaaaagttaaaacctgataatatgggtgctgcc
aagacttatttgttgaatctaggaataaaaggttttggtgaaaaatccgtagagaaggta
ctagagtatttcggtattcgtattttagaaattttacgggaagaacgtccagaagagatt
aaggatgttccaggtctccgaaagagtgttaaggatgaattatttaataccttacttggt
gaaggtattttatccgatttaaatcatttttttgaaagtcatcacatttcatcgaaatgg
agtcgcattgtatatacctattatggtgtgcagtcagttgcagttatagaggataatcct
tatacattattacgtgtagcaccggatatgctctttggtacggccgatacactagcagag
catcttggtattaatggtagtgatacacgccgtttagaggctggtttagaatggattcta
cgtagtttagataatcaaggtcatacatgtttaccagtagaccaacttatcggtcgactt
gacgatttattacaaactgatgtagatgatattgcgaactttattgaaagtttgctggaa
caaggtgcactgtatagtacgtattatgaagacatcttatatatctatccgccagagatg
tatgtttctgaagtggaaggggtccactatactcgtgagtttctattacaagctgatcca
atagcattagatatttctagttttattgaaaagtttgaacgagacaactacattactttt
ggtgatgctcaaaaagaagctatacagctctcattttttgaaaagttttctcttataact
ggtggtcctggtacaggtaaaacaactatcatcaaggcgctagtaaaaggtttccaactc
ggtggattggggcgcattatactttgtgctcctacgggacgtgctgcaaagcgtctgacc
gaggccactgagtttgaagctactacaattcatcgtctattggtacctgttcaaggtagt
gactcctatgactttacaaagaatgaagatgatcctctagatatagatgtcattatcatc
gatgaagcatctatgcttaatgtgcgtttattctattctttgatggctgctattccaaag
gaagcccatgtcattattgtgggtgacgtagatcaattaccacctataggtgctgggttc
gtattaaaagatttattagatagtgattgtgtgccctatacacgacttaatcagatttat
cgtcaaagctctggtaatactatcgttgaaagtgcttacgcaattaaccgtggtgaaatg
cctaacctggaaggtgtgagcgaagagttttcttttattcctgttaaatcttatgatatg
atgatgaaagccatcattgatgtatataaacgtgaacaagagacgatagaggatgaatta
gatattcaaattatttctcctatgcgccgtggtgaagcaggtagtacattgatatcacaa
tatgtacaacaagccgtaaaccctccagacagctataagggagaagttcgtgtcaatggc
attacgtatcgcgttggggataaggttattcaaattctcaatgattatgagttagaagtg
tttaatggcgaaattggcgttatctatgctattacgcggaccgatatttgtattcgattt
atccataaagaggttcgtctacctatcgatgaagcacatatgattatgcctgcttatgct
attacagttcataagagtcaaggtagtgagtatggtgtagttattattccatttgttcca
cgttatggtggcatgttacaacgtaatttgttgtatactgctgttacacgggcaaagcgt
aaagtaatcatcgttggtactacgagcgcagttgaacgtgctgtgcgtactgttaatgcc
gatgaacgttacacattgtttaaagaacgactacaagggagatgtgattcgtaa

DBGET integrated database retrieval system