KEGG   Veillonella parvula: Vpar_0813Help
Entry
Vpar_0813         CDS       T01130                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
vpr  Veillonella parvula
Pathway
vpr00330  Arginine and proline metabolism
vpr00332  Carbapenem biosynthesis
vpr01100  Metabolic pathways
vpr01130  Biosynthesis of antibiotics
vpr01230  Biosynthesis of amino acids
Module
vpr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Vpar_0813
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Vpar_0813
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Vpar_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACZ24494
JGI: Vpar_0813
UniProt: D1BM87
Position
955924..957045
Genome map
AA seq 373 aa AA seqDB search
MRSAIVNAKRIVVKVGSSTLCYTNGHLNLERIERLVRQLSDLANQGKEIILVSSGATGAG
LAPLGFKEKPRDLVLKQAAAAVGQGILIHMYERMFREYGRTVGQILLTKEDSTGRHSYLN
LRNTLHTLLQLNVIPIINENDVVAIEEFKIGDNDTLSATVAGIVDADLLIILSDIEGLYT
ANPAINPDATLIETVSEINDETYAIAGGAGSNMGTGGMYTKIKAAHMATNSGVPMVITSG
EVEDSVRRVCKGEQIGTLFEAHDASLSGKHHWLAFGKRLKGSITIDDGCARAVLDNGASI
LPAGIIEVEGTFGPGDTISIYHDHKEIGRGLINYSIDDMKAIKGHNTNDIAEILGINTTY
DEAVHRNNLVLLH
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcgctatcgttaatgcaaaacgaattgtagtcaaagttggtagcagtacgctt
tgttacactaacggacatttaaatttggagcgtattgaaagattagtgcgccaattatca
gatttggctaaccaaggtaaagagattattcttgtttcctctggtgctactggtgcaggt
cttgcccctttaggctttaaagaaaagcctagagatctcgtattaaaacaagcagctgct
gcagtaggtcaaggtattctcattcatatgtacgagcgcatgttccgagaatatggtcgc
accgtagggcaaattcttttaacgaaagaggatagtactggacgacatagttatcttaac
ttgcgtaatacattacatactttattgcaacttaacgttattcctattattaatgaaaat
gacgtggttgctatcgaagaatttaaaatcggtgataacgatacattatctgctactgtt
gcaggtattgtagatgcagatttacttatcattttgtcagatattgaaggcttatataca
gctaacccagccatcaatccagatgctactttgatagagactgtttctgaaattaacgat
gaaacgtatgctattgcaggtggtgctggttctaatatgggaacggggggtatgtataca
aaaattaaagctgctcatatggcaacaaattctggtgtaccaatggttatcacctcaggt
gaagtagaggattctgttcgtcgtgtatgtaagggtgaacaaattgggacactctttgaa
gcccatgatgcaagtttatctggtaaacatcattggttggcttttggtaaacgattaaaa
ggatccattacgattgatgacggatgtgctcgcgctgttttagataatggtgctagcatt
ctgcccgctggtattattgaagtagaggggacttttggacctggtgatacaatttccatt
tatcatgatcataaggaaattggtcgtggacttattaattatagtattgatgatatgaag
gcgattaaaggtcacaatacaaatgatatagccgagattctgggtattaatacgacctat
gatgaggctgtacatcgtaataatctagttttattacactga

DBGET integrated database retrieval system