KEGG   Veillonella parvula: Vpar_1017Help
Entry
Vpar_1017         CDS       T01130                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
vpr  Veillonella parvula
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Vpar_1017
Enzymes [BR:vpr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Vpar_1017
Amino acid related enzymes [BR:vpr01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Vpar_1017
Transfer RNA biogenesis [BR:vpr03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Vpar_1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1178175..1179644)
Genome map
AA seq 489 aa AA seqDB search
MSSMKVRFAPSPTGPFHIGGARSALFNWLLARKEKGTFVLRIEDTDLTRSTRESEENIKA
SLQWLGMNWDEGIDVGGNNGPYRQTERLDLYKEVTQRLLDEGKAYECYCTPEELDAVRQD
QMERGETPKYNGHCEHLDEETKAKYIAEGRKPTIRLRVPLNKTYAFDDMVRGHVSFESNG
VGDFVIVKSDGIPVYNFAVVMDDHMMGITHVIRAEEHLSNTPRQMAIYEALGWEVPKFGH
ISLILGKDYKKMSKRHGATSVEQYKQLGYLPEALVNFLALLGWAPEGEEEFFTQDELIQA
FSMDRVAKNPAVFDIDKLNHINFHYMKNLSDEELFHLCLPHLKEVGLAPDSLNQADIDWL
TLLCSTFRDHISYGAQIKDHVGLFMGETVFLEEGHEEELRAVLNEETASIVLCAFRNALA
ELDEITPEVVKATIKAVMKETSLKGKFVFMPIRVALTGQMHGPDLNNIVTLLGKEKCLHR
LDNVGALTK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagttccatgaaagttcgttttgctccaagccctacgggaccattccatattggtggt
gctcgttctgctttgtttaactggctattagcacgtaaggaaaaaggcacatttgtattg
cgcattgaagatacagatttaactcgttctacacgtgaaagtgaagagaatattaaagct
tccttacaatggcttggcatgaactgggatgaaggcattgatgtaggcggtaataatggt
ccttaccgtcaaacagaacgtcttgatttatataaagaagtaacacaacgcttattggat
gaaggtaaagcttatgagtgttattgcacccctgaagagttagatgcggtgcgtcaagat
caaatggagcgtggggaaacaccgaaatacaatggtcattgtgaacacttagatgaagag
acaaaggctaaatacattgctgaaggtcgtaaacctacaattcgtttgcgtgtaccgttg
aataaaacatatgcttttgatgatatggtacgtgggcatgtatcctttgaatctaatggt
gttggtgattttgtaattgtaaaatctgatggcattcctgtatataactttgctgtagta
atggacgatcatatgatggggattactcacgttattcgtgcggaagaacatctatccaat
acacctcgacaaatggccatatatgaagctcttggctgggaagtccctaagtttggtcat
atttctttaattcttggtaaagactacaagaaaatgtccaaacgtcatggtgctacttct
gttgaacaatacaaacaattaggctacttaccagaagcacttgtaaacttcttggcactt
cttggttgggctcctgaaggtgaagaagaattcttcacacaagatgaattaattcaggct
ttttctatggatcgggtagcgaaaaatcctgctgtgtttgatattgataaattgaaccat
ataaatttccactacatgaagaatttgagtgatgaagaattattccacctttgtttgccg
catttgaaagaggttggtttagctccagatagcttgaatcaagctgatatcgattggttg
acattattatgctctacattccgtgatcatattagctatggtgctcaaatcaaagatcat
gtaggcttgtttatgggcgaaacagtattccttgaagaggggcatgaagaagaattgcgt
gctgtattgaatgaagaaacagcttcaatagttctctgcgctttccggaatgcattggct
gaacttgatgaaattacacctgaagttgtaaaagcaacaatcaaggccgtaatgaaagaa
acctctttaaaaggtaaattcgtatttatgccaattcgtgtagctttaacaggtcaaatg
catggtccagatttgaataatattgttacattacttggtaaagaaaagtgcttacatcgt
ttagataatgtaggtgcattaacaaaataa

DBGET integrated database retrieval system