KEGG   Veillonella parvula: Vpar_1073Help
Entry
Vpar_1073         CDS       T01130                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vpr  Veillonella parvula
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vpar_1073
   01230 Biosynthesis of amino acids
    Vpar_1073
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vpar_1073
   00030 Pentose phosphate pathway
    Vpar_1073
   00051 Fructose and mannose metabolism
    Vpar_1073
   00052 Galactose metabolism
    Vpar_1073
  Energy metabolism
   00680 Methane metabolism
    Vpar_1073
Enzymes [BR:vpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Vpar_1073
Protein phosphatases and associated proteins [BR:vpr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Vpar_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1241123..1242082)
Genome map
AA seq 319 aa AA seqDB search
MRRIAILTSGGDAPGMNAAIRALTRKAIHEGFEVFGIERGYLGIIEEKIFPLSNRDVGGI
ITQGGTMLKTARFPEFQNEEIQRKAYNILKAYDIDHLVVIGGDGSMRGATSLSKLGMSTM
TIPCTIDNDMGGTQYTIGYDTALNTVVDAVGRIRDTSNSHERVAIVEVMGRKAGHIALKA
GLVCGAEIVLVPENPMPLHAVCRHLKETQIRGKEYSVILVAEGAYNSGEVKAFIKEHTEF
DPSLTVLGYLQRGGGPSAFDAILAARMSEACLNLLMSGVDNRLVGYIDGHIRALSYEEAE
RLEFPIDEKDYRLLSILSS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaatcgcaatactaacaagcggcggagacgcacctggaatgaacgccgccata
agagcgctaactagaaaagctatacatgaaggttttgaagtatttggtattgaacgtggc
tatttaggtatcattgaggaaaagatatttccattatcgaatcgagacgttggtggcatc
ataacacaaggtggtacgatgctgaaaacagcacgttttccagaatttcaaaatgaagag
attcaacgcaaagcttataatattttgaaagcttatgacattgaccatttggttgttatc
ggtggtgatggctccatgcgtggtgctacaagtttatctaaacttggcatgtccaccatg
accattccatgtacgatagataatgacatgggtggtacacaatatacgataggctatgat
acggctcttaatacggtagttgatgcggttggacgtattcgggatacctcaaactcccat
gaacgtgtagctattgtggaggttatggggcgcaaagctggacatattgcattaaaggca
ggcctagtttgtggggcagaaatagttttggttcctgaaaatccaatgcctttacatgcg
gtgtgtcgtcatttaaaggaaacacaaattcggggtaaagaatatagtgttatccttgtt
gcagaaggtgcctataacagcggtgaggtgaaagctttcatcaaggagcatacggaattt
gatcctagcttaaccgtgttaggatacttacaacgtggtggtggtccatcggcatttgat
gctattttagcggctcgtatgagtgaagcctgccttaatctattaatgagtggtgtcgat
aaccgattagtaggttatatagatggtcatatccgcgccctatcttatgaagaggcagaa
cgtcttgaatttccaattgatgaaaaggattatagactattatcaatattgagtagttaa

DBGET integrated database retrieval system