KEGG   Veillonella parvula: Vpar_1088Help
Entry
Vpar_1088         CDS       T01130                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vpr  Veillonella parvula
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vpar_1088
   01230 Biosynthesis of amino acids
    Vpar_1088
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vpar_1088
   00051 Fructose and mannose metabolism
    Vpar_1088
   00562 Inositol phosphate metabolism
    Vpar_1088
Enzymes [BR:vpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Vpar_1088
Exosome [BR:vpr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Vpar_1088
  Exosomal proteins of bladder cancer cells
   Vpar_1088
  Exosomal proteins of melanoma cells
   Vpar_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1254079..1254849)
Genome map
AA seq 256 aa AA seqDB search
MRKLIIAGNWKMNGTIASGSILIEAFNSVLQDMELFCDVVVCPPFTAIEHAVALTKNTAM
EVGAQTMDYHDAGAFTGEISPLMLTEVGVNYVIIGHSERREYYGETDETVNAKIKSAFHH
NLNPIVCVGESLEQRETGHTIDWITSQLKGALADIPKEQVSQLIIAYEPIWAIGTGKTAT
ADQAEEVCKEIRSYIRSLYDSETAEAIRIQYGGSVKSENALEILGEPNIDGALVGGASLV
VDEFIDIIKAANQVSA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactcattattgcagggaattggaaaatgaatggcaccattgcatctggatca
attctgatcgaagcgtttaacagcgtgttacaagatatggaattgttctgtgatgtagtt
gtatgtccgcctttcacagccatcgaacatgcggtagcattgacgaaaaatacagctatg
gaagtaggcgcacaaactatggattatcatgatgctggtgcgttcactggtgaaatttca
ccacttatgcttacagaggtaggcgttaattatgtaatcattggtcattctgagcgccgt
gaatattatggcgaaacagatgagacggtaaatgcaaaaattaaaagtgcatttcatcat
aatttgaatcctattgtctgtgttggtgaaagcttagaacaacgtgaaactggtcatacg
attgactggattacgtcacaacttaaaggggctttggctgatattcctaaagagcaagtc
agccaattgattattgcgtatgaaccaatttgggctatcggtactggcaagaccgcaacg
gctgatcaagccgaagaggtatgtaaagaaattcgaagttacattcgatctttatacgat
agtgaaactgctgaggcaatacgcatccaatatggtggtagcgttaaatcagaaaatgca
ttagaaattcttggagagcctaatatagatggagctcttgtaggtggtgcatcccttgtg
gttgatgaatttattgatattattaaagcggcgaatcaagtaagcgcttaa

DBGET integrated database retrieval system