KEGG   Veillonella parvula: Vpar_1088Help
Entry
Vpar_1088         CDS       T01130                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vpr  Veillonella parvula
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:vpr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vpr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vpr00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:vpr00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1254079..1254849)
Genome map
AA seq 256 aa AA seqDB search
MRKLIIAGNWKMNGTIASGSILIEAFNSVLQDMELFCDVVVCPPFTAIEHAVALTKNTAM
EVGAQTMDYHDAGAFTGEISPLMLTEVGVNYVIIGHSERREYYGETDETVNAKIKSAFHH
NLNPIVCVGESLEQRETGHTIDWITSQLKGALADIPKEQVSQLIIAYEPIWAIGTGKTAT
ADQAEEVCKEIRSYIRSLYDSETAEAIRIQYGGSVKSENALEILGEPNIDGALVGGASLV
VDEFIDIIKAANQVSA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactcattattgcagggaattggaaaatgaatggcaccattgcatctggatca
attctgatcgaagcgtttaacagcgtgttacaagatatggaattgttctgtgatgtagtt
gtatgtccgcctttcacagccatcgaacatgcggtagcattgacgaaaaatacagctatg
gaagtaggcgcacaaactatggattatcatgatgctggtgcgttcactggtgaaatttca
ccacttatgcttacagaggtaggcgttaattatgtaatcattggtcattctgagcgccgt
gaatattatggcgaaacagatgagacggtaaatgcaaaaattaaaagtgcatttcatcat
aatttgaatcctattgtctgtgttggtgaaagcttagaacaacgtgaaactggtcatacg
attgactggattacgtcacaacttaaaggggctttggctgatattcctaaagagcaagtc
agccaattgattattgcgtatgaaccaatttgggctatcggtactggcaagaccgcaacg
gctgatcaagccgaagaggtatgtaaagaaattcgaagttacattcgatctttatacgat
agtgaaactgctgaggcaatacgcatccaatatggtggtagcgttaaatcagaaaatgca
ttagaaattcttggagagcctaatatagatggagctcttgtaggtggtgcatcccttgtg
gttgatgaatttattgatattattaaagcggcgaatcaagtaagcgcttaa

DBGET integrated database retrieval system