KEGG   Veillonella parvula: Vpar_1088Help
Entry
Vpar_1088         CDS       T01130                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vpr  Veillonella parvula
Pathway
vpr00010  Glycolysis / Gluconeogenesis
vpr00051  Fructose and mannose metabolism
vpr01100  Metabolic pathways
vpr01110  Biosynthesis of secondary metabolites
vpr01120  Microbial metabolism in diverse environments
vpr01130  Biosynthesis of antibiotics
vpr01200  Carbon metabolism
vpr01230  Biosynthesis of amino acids
Module
vpr_M00002  Glycolysis, core module involving three-carbon compounds
vpr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vpar_1088
   00051 Fructose and mannose metabolism
    Vpar_1088
   00562 Inositol phosphate metabolism
    Vpar_1088
Enzymes [BR:vpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Vpar_1088
Exosome [BR:vpr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Vpar_1088
  Exosomal proteins of bladder cancer cells
   Vpar_1088
  Exosomal proteins of melanoma cells
   Vpar_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Csa1
Motif
Other DBs
NCBI-ProteinID: ACZ24769
JGI: Vpar_1088
UniProt: D1BN12
Position
complement(1254079..1254849)
Genome map
AA seq 256 aa AA seqDB search
MRKLIIAGNWKMNGTIASGSILIEAFNSVLQDMELFCDVVVCPPFTAIEHAVALTKNTAM
EVGAQTMDYHDAGAFTGEISPLMLTEVGVNYVIIGHSERREYYGETDETVNAKIKSAFHH
NLNPIVCVGESLEQRETGHTIDWITSQLKGALADIPKEQVSQLIIAYEPIWAIGTGKTAT
ADQAEEVCKEIRSYIRSLYDSETAEAIRIQYGGSVKSENALEILGEPNIDGALVGGASLV
VDEFIDIIKAANQVSA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactcattattgcagggaattggaaaatgaatggcaccattgcatctggatca
attctgatcgaagcgtttaacagcgtgttacaagatatggaattgttctgtgatgtagtt
gtatgtccgcctttcacagccatcgaacatgcggtagcattgacgaaaaatacagctatg
gaagtaggcgcacaaactatggattatcatgatgctggtgcgttcactggtgaaatttca
ccacttatgcttacagaggtaggcgttaattatgtaatcattggtcattctgagcgccgt
gaatattatggcgaaacagatgagacggtaaatgcaaaaattaaaagtgcatttcatcat
aatttgaatcctattgtctgtgttggtgaaagcttagaacaacgtgaaactggtcatacg
attgactggattacgtcacaacttaaaggggctttggctgatattcctaaagagcaagtc
agccaattgattattgcgtatgaaccaatttgggctatcggtactggcaagaccgcaacg
gctgatcaagccgaagaggtatgtaaagaaattcgaagttacattcgatctttatacgat
agtgaaactgctgaggcaatacgcatccaatatggtggtagcgttaaatcagaaaatgca
ttagaaattcttggagagcctaatatagatggagctcttgtaggtggtgcatcccttgtg
gttgatgaatttattgatattattaaagcggcgaatcaagtaagcgcttaa

DBGET integrated database retrieval system