KEGG   Veillonella parvula: Vpar_1192Help
Entry
Vpar_1192         CDS       T01130                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vpr  Veillonella parvula
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vpr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1363554..1364117)
Genome map
AA seq 187 aa AA seqDB search
MDTKKIESLIYQLLEALGEDPNRDGLLETPKRVAQMMEEVYEGIQYTNAEIAEMYGKTFA
VDTNQMVVVKDITCFSHCEHHMALMYDMSISIGYIPKGHVIGLSKIPRIAEMCCKRLQLQ
EKIGEDIAEVISLATGSDDVIVHIISSHSCMSARGIKSTDSQTTTLTTKGVFNEDHMIHR
FMLMKQS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaaaaaatagaatcacttatatatcagttgttagaagcattaggtgaggat
cctaatcgggacggtttgttagaaacaccgaaacgggtggctcaaatgatggaagaggta
tatgaaggcattcagtatacaaatgctgaaattgcagaaatgtatggtaaaaccttcgct
gtagatacaaatcaaatggtagtagtaaaggatattacttgcttctctcattgtgaacat
catatggcattgatgtatgatatgagtatcagtattgggtatataccaaaaggtcatgtc
ataggtttatctaagattcctcgcatagctgaaatgtgttgcaagcgtttacaattgcaa
gaaaaaattggtgaagatattgcggaagtaatttctttagcgacagggtctgatgatgtt
attgtgcacattatatcgtcccacagctgcatgagtgcaagaggcattaaatctacagat
agccaaacgactacactaactactaaaggcgtatttaacgaagatcatatgattcaccgt
tttatgctaatgaaacagtcttaa

DBGET integrated database retrieval system