KEGG   Veillonella parvula: Vpar_1282Help
Entry
Vpar_1282         CDS       T01130                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vpr  Veillonella parvula
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vpar_1282
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vpar_1282
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Vpar_1282
Enzymes [BR:vpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Vpar_1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1466898..1468397)
Genome map
AA seq 499 aa AA seqDB search
MNYTSTRGTVAVNETYALLHGLAEDGGLYVPSLFPTNCLTYNDVKDKNYQEVAAVVLAKL
FPCFSEAHLNEMINSAYCDANFSTRDIAPLHSLLEKVSVLELFHGRTQAFKDMALSLFPY
LLVAAKEAEGEKKEVLILTATSGDTGKAALEGFKDVPGTHIQVFYPTDGVSPMQAEQMQK
QEGENVNVTAIHGNFDDAQQFLKRLFVDKATAEEVAEKGVMFSSANSINIGRLAPQVVYY
VNAYAELVAQGAIHEDEAFNVVVPTGNFGNILAAYYAKKMGIPIGKLICASNQNNVLTDF
FENGTYDMNRPFYTTISPSMDILESSNFERFLYYISGEDSERTVGWMKDLKTTGKLTVNE
EEFKRVKTDFAGAYVDDEETKAIIEQVYNSYGYVMDPHTAVAMGAYMKELEKHPEDGARH
TVIASTAHPFKFPTPICEALDIKVGETPYESLDNISAVTGVAFPKQLEALQSKPLRFTKA
IDKENMKQEILDFVDTFSK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaattatactagcacccgaggtaccgttgcggtaaatgaaacatatgcattgttgcac
ggcttagcagaggatggtggcctatatgtaccatctttatttcctacaaactgcttaact
tacaatgatgtgaaagataaaaactaccaagaagtagcagccgttgttttagcaaagttg
tttccatgcttttccgaagctcatttaaatgaaatgattaattctgcttactgcgatgct
aatttcagcacccgcgatattgcaccattacactctttattggaaaaggtttccgtattg
gaactattccatggccgcacacaagctttcaaagatatggccttgtccttattcccatat
ttgttagtggcagctaaagaggcggaaggtgagaaaaaagaggttcttatcttaacggct
acctctggtgatactggtaaagcggctcttgaaggcttcaaggatgtaccgggaactcat
attcaagtattctatccaactgatggcgttagtcctatgcaagcggaacaaatgcaaaaa
caagaaggggagaatgttaatgttacggctattcatggtaactttgacgatgctcagcaa
ttcttgaagcgcctctttgttgataaagcgactgctgaagaggttgctgaaaaaggggtt
atgttctccagtgcgaattctatcaatattggtcgtttagctccacaagtagtttactat
gtaaatgcctatgctgaactggttgcacaaggtgcaatccatgaagacgaagctttcaac
gttgtagttccaacaggtaacttcggtaatatcttggctgcttactatgctaaaaaaatg
gggattcctatcggcaaattgatttgtgcatctaatcaaaataacgtacttactgacttc
tttgaaaacggtacctacgatatgaaccgcccattctatacgacgatttctccatctatg
gatattcttgaatcctctaactttgaacgattcttatattatatttctggtgaagatagc
gaacgtacagtaggatggatgaaagatcttaaaacaacaggcaaattaactgttaatgaa
gaagagttcaaacgtgttaagactgattttgctggtgcctatgtagatgatgaagaaacg
aaagcaatcattgaacaagtatacaattcttacggttatgtaatggatcctcacacggca
gttgctatgggggcgtatatgaaggagttggagaagcatcctgaagatggcgctcgtcat
acagtgattgcatctacagcacatccatttaaatttcctacaccaatctgtgaggcattg
gatatcaaggtgggcgagactccttatgaaagcttagataatatctctgctgtaacgggt
gttgccttccctaaacaattggaagccttacaatccaaaccattgcgctttacaaaagca
atcgacaaagagaatatgaaacaagaaatcttagattttgtagatacattctctaaataa

DBGET integrated database retrieval system