KEGG   Veillonella parvula: Vpar_1424Help
Entry
Vpar_1424         CDS       T01130                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
vpr  Veillonella parvula
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vpr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1643188..1644696)
Genome map
AA seq 502 aa AA seqDB search
MTGMVYLIGAGPGDVKLITVKGRECIEKADVIVYDYLADAHLLEWAHPDAELIYAGKQCK
DHTMHQWEINELLVQKGKEGKIVARLKGGDPLVFGRGGEEAMALGEAGVPFEFVPGVTSP
IAAPAYAGIPVTQRAMATSFAVVTGHEDPTKAVSGIHWEGLATAVDTLCFVMGVGNLPVI
AEKLMAHGRSASTPVALVRWGTKTVQEVLVSTLEHVVEDVAKAQLKAPAIIVVGDVVNLR
EKLQWFDNKPLFGKTVVVTRARSQASAFREKLAAQGANVVEAAAIKTSPLELFEEDKRII
NNTKEYQCIVFTSGEGVRYFFDALYKEGKDTRALGNSKVAAIGCATARELQKYGIVPDII
PVDYKAESAVEALEEELNAGDSVLLIQPKVARDVIPRCLRHRDMNVDILRLYETTQDTSQ
QEALVTALTEGNVDYITFTSSSTVTNTIQLLGDNALELLGKTKVACIGPITAATAMSAGL
KPAIISDAYTTDGLVNAIVKDI
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtatggtatatctaatcggtgcaggccctggcgatgttaaactcatcaccgta
aaaggtcgtgaatgtatcgaaaaagcagatgtaattgtatatgattatttagcagatgct
catctgttagagtgggcacatcccgatgcagaattgatttatgctggtaaacaatgtaaa
gatcacacgatgcatcaatgggaaatcaatgagctattagtccaaaaaggtaaagaaggc
aaaatcgtagcacgattaaaaggcggtgatccgctcgtatttggtcgtggtggtgaagaa
gcgatggctcttggcgaagccggtgtgccatttgagttcgtgccaggtgtaacatctcct
atcgcagcgcctgcctatgcagggattcctgtaacacaacgcgctatggccacatccttt
gcggtggtaacaggtcatgaggatcctacaaaagcagtatctggtatccattgggaaggc
cttgctacggcggtagatacactttgctttgtaatgggtgttggtaacttgccagtcatt
gcggaaaaattgatggctcatggccggtcagcctctacaccagtagcgcttgttcggtgg
ggaacaaaaacagtacaagaggtattagtttctacccttgaacatgtcgttgaagatgta
gcaaaggctcaattgaaagcgccagctatcatcgtagtaggtgatgttgtcaaccttcgt
gaaaaattacaatggttcgataataaacctttattcggtaaaactgtcgtagtcacacgc
gctcgctcccaagcaagtgcattccgcgaaaaattagcggctcaaggtgctaatgtagtg
gaagcagcagccataaaaacatctccattggaattgtttgaggaagataaacgcatcatc
aacaatacaaaagaataccaatgtatcgtattcacatctggtgaaggggttcgttacttc
ttcgatgctctatataaagaaggcaaagatacacgtgctttaggtaattctaaagtggcg
gctatcggctgtgctacggctcgtgaacttcaaaaatatggcatcgtaccggatatcatt
cctgtagactacaaggctgaatctgctgtagaggctcttgaagaagaactcaatgcaggg
gattctgtactgttgattcaaccaaaggtagcacgcgatgtgattccacgttgcttgcgt
caccgcgatatgaatgtagatatcttgcgtttatacgaaactacacaagatacatctcaa
caagaagcattagtaacagcgttaacagaaggcaatgtagattatattaccttcacaagc
tcctctactgtaacaaatacaatccaattattgggcgacaatgcactagagttattaggc
aaaactaaagtggcttgcatcggtccaattacggctgctacggctatgagtgcaggtctt
aaaccggctatcatcagcgatgcatatacaacagatggcttagtaaatgctattgtaaaa
gacatttag

DBGET integrated database retrieval system