KEGG   Veillonella parvula: Vpar_1634Help
Entry
Vpar_1634         CDS       T01130                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vpr  Veillonella parvula
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vpr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1865646..1866242)
Genome map
AA seq 198 aa AA seqDB search
MTNALERLVEQLRRLPGIGSKSARRLAYHLVEMPKEEVDRLVETIVEAKGATRHCSICFN
LSAQDPCEFCSNPNRDHTTIMVVETSRDVIAIERSGDYKGLYHVLEGALSPMEGIGADDI
RVKELIARLRDGVVQEVILATDPDVEGEATALYLARLLSPSGIKVTRIARGVPVGGDIEY
ADELTLGGAVVNRQEMKG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgctttagaacggctcgtagaacagctgcgccgcttgcctggcatcggttct
aagtcggctagacgcttggcgtaccatttggtagaaatgccgaaggaagaggtggaccgc
ctcgtggaaactatcgtagaagcgaagggggctacgcgtcactgttctatttgctttaac
ttatcagctcaagatccttgcgaattctgtagcaatccaaatcgcgatcatacgacgatt
atggttgttgaaacatctcgtgatgtcattgctatcgagcgcagtggtgattataagggc
ttgtatcatgtattggaaggtgccttgtcccctatggagggcatcggtgccgatgatatt
cgcgtaaaagaattgattgcacgccttcgcgatggcgttgtacaagaggttatcctcgcg
acagatccagatgtcgaaggggaagcaacagctctgtatttggcgcgcttattaagtcca
agtggcatcaaggtaacgcgcattgcccgcggtgttcctgtggggggcgatatcgaatat
gccgatgaattaacgctaggcggtgccgtagtgaaccgtcaagaaatgaaaggatag

DBGET integrated database retrieval system