KEGG   Veillonella parvula: Vpar_1713Help
Entry
Vpar_1713         CDS       T01130                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
vpr  Veillonella parvula
Pathway
vpr00480  Glutathione metabolism
vpr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vpr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Vpar_1713
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Vpar_1713
Enzymes [BR:vpr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Vpar_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ACZ25389
JGI: Vpar_1713
UniProt: D1BPT2
Position
complement(1969053..1969595)
Genome map
AA seq 180 aa AA seqDB search
MSVYQFSLPTKSGELQSLQTYEGKVLIIVNTASKCGFTHQYEGLEALYKQYKEQGLEIIA
VPSNQFGEEEPGSNNEIQSFCKLNYGVTFTVMGKADVRDESALDLFKYMIREQPFQGFPP
SDKTEMLTDYLNGIDPNYLKDDEVKWNFTKFVIDRKGNVVGRFEPVVKPMEMEAFIKKLI
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtatatcaattttccctgcctactaagtctggggaattacaatccttacaaact
tatgaaggtaaagttcttatcattgttaatacggcgagtaaatgtgggtttactcaccaa
tatgaggggctagaagctctttataagcaatataaagagcaaggattagaaattattgct
gttccttccaatcaatttggagaggaagaacctggttctaataacgaaatccaatccttc
tgcaaattgaattacggtgtcacttttacagttatggggaaagcagatgtacgcgatgaa
agtgcattagacctttttaaatacatgatacgagaacaaccgttccaaggcttcccacct
agtgataaaactgaaatgcttacagattatctcaatggtatcgatcctaattatttaaag
gacgatgaggtaaagtggaattttactaagtttgttatagatcgtaaaggtaatgtggta
gggcgcttcgagcctgttgttaaaccgatggaaatggaagctttcattaaaaaacttatt
tag

DBGET integrated database retrieval system