KEGG   Vigna radiata (mung bean): 106774325Help
Entry
106774325         CDS       T04126                                 

Definition
(RefSeq) beta-fructofuranosidase, cell wall isozyme
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
vra  Vigna radiata (mung bean)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    106774325
   00500 Starch and sucrose metabolism
    106774325
Enzymes [BR:vra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106774325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
9
AA seq 562 aa AA seqDB search
MIMPTMCLLILFSVIYGSVATHHFSRNLQTLSSDSNDQPYRTAYHFQPPKNWINDPNGPM
RYGGLYHLFYQYNPKGAVWGNIVWGHSVSKDLVNWTTLDPAIFPSQPSDINGCWSGSTTL
LPGNKPAILYTGIDSMKNEVQNLAKPKNLSDPFLREWDKFPQNPVMQPTSDNKIVPDSFR
DPTTAWLGQDGHWRVLVGSRRRTRGMALLYRSKDFVNWVQAKHPFYSTKDSGMWECPDFF
PVLKNGQLGVETSVNGDDVRHVLKASLKGHDDYIIGNYNTAKDVFVPDKGFDEFVLRFDY
GKYYASKSFFDDGKKRRVLLGWVDESSSEADDIKKGWSGIIAIPRAIWLHRSGKQLVQWP
VMEIEKLRANPVSLPPQVLKGGQLLQINGVTATQADVEISFEVSKLIEAEVLENWTDPQI
LCSQKGSSIKSELGPFGLLVFASEGLEEFTSVFFRIFKYQNKNLVLLCSDQSRSSLNKDN
GLTTYGAFVDVEPLHEQLSLRTLTDHSVLESFGGEGRACITARVYPTLAINDKAQLYAFN
NGTADVNITRLNVWSMKKAQIN
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgataatgcctactatgtgtttgttaattctcttttctgtcatttatggcagtgtagcc
actcatcattttagcagaaatcttcagactctgtcttctgattccaatgatcaaccttac
agaacagcttatcacttccaacctcccaagaattggataaatgatcccaatggaccaatg
agatatggaggactttatcatctgttctatcaatacaatccaaaaggtgcagtttgggga
aatattgtgtggggacattcagtgtcaaaggatcttgtgaactggaccacactagatcct
gccatcttcccatctcagccgtctgatataaatggttgttggtcaggatcaaccacactg
cttcctgggaacaaaccagccattttgtatacaggaattgactccatgaaaaacgaagtc
caaaacttggccaagcccaaaaatttgtctgacccttttcttagggaatgggataagttc
ccccaaaaccctgtaatgcaaccaactagtgataacaaaatagttccagactcatttagg
gatcccaccactgcttggctaggacaagatggacactggagagtacttgttggaagcaga
agaagaactaggggaatggcactgttgtataggagcaaagactttgttaattgggttcaa
gccaagcaccctttttattcaaccaaagacagtggaatgtgggagtgcccagattttttt
ccagttttgaagaatggtcaattgggtgttgagacatctgtgaatggtgatgatgttagg
catgtactcaaggctagcttgaaaggacatgatgattatattatagggaattataatact
gccaaggatgtgtttgtccctgataaagggtttgatgaatttgttttaagatttgattat
ggaaaatactatgcctcaaaatctttctttgatgatggaaagaagagaagggttttgctt
gggtgggtggacgaatcatcaagtgaggcagatgatatcaagaaaggatggtctggaatc
attgcaattccaagagccatttggttgcacaggtctggtaaacagctggtacaatggcct
gtgatggaaattgaaaaactgcgtgcaaacccagtgagcttgcccccacaagtgctaaaa
ggaggacaattgcttcaaattaatggtgttacagcaacacaggctgatgttgaaatttca
tttgaagtgagtaaattgatagaagctgaagtattggaaaattggacagacccccaaatt
ctgtgtagtcaaaagggttcatccattaaaagtgaattggggccgtttggtctgctagtt
tttgcttctgagggattggaagagttcacatcagttttcttcagaatattcaaataccaa
aataaaaatttggtgctcttatgcagtgatcaaagcaggtcttccttaaataaagacaat
ggtttgaccacttatggagcttttgttgacgtggaacctcttcatgaacagctttcactg
agaacactgactgatcattctgtcctagagagttttggaggagagggaagagcttgtatc
acagccagagtttaccccacattggcgatcaatgataaagcacaactatatgctttcaat
aatggtactgctgatgttaatattacaagactgaatgtttggagcatgaagaaagcacaa
ataaattga

DBGET integrated database retrieval system