KEGG   Aliivibrio salmonicida LFI1238: VSAL_I0177Help
Entry
VSAL_I0177        CDS       T00782                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
vsa  Aliivibrio salmonicida LFI1238
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:vsa00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:vsa00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(217730..218287)
Genome map
AA seq 185 aa AA seqDB search
MNVIDTNIPDVKIFEPTVFGDERGFFMETWSQKKFEELVTGKPTQFVQDNHSKSKKGILR
GLHYQTENTQGKLVRVVSGEVFDVVVDIRENSPTFGQWVGTYLSAENKHQLWVPEGFAHG
FYVTSEDAEFVYKCTDYYNPKSEISIAWDDKAIGIEWPITTPPQLSEKDKNAMILSQVTP
IKQED
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttatagataccaatattcctgatgtaaaaatattcgagccaacggtgtttggg
gatgaacgtgggtttttcatggaaacatggagccagaagaagtttgaagaattagtgacg
ggaaaaccaactcagtttgtacaagataaccattcaaaatctaaaaaagggattttgcgt
ggcttgcattaccaaacagaaaacacccaagggaaactagtacgtgtagtttcaggagag
gtgtttgatgtagtggttgatattcgtgaaaattccccaacctttggtcaatgggttggc
acttatctttctgctgaaaacaaacatcaactctgggtgccagaaggctttgctcatggt
ttttatgtgacaagtgaagacgctgagtttgtctataaatgcacggattattataaccca
aaatcagaaatctcaattgcttgggatgataaggctattggtattgaatggccaatcacg
actccacctcaattatctgagaaagataaaaatgcgatgatattatctcaagtcacaccc
ataaagcaggaggactag

DBGET integrated database retrieval system