KEGG   Aliivibrio salmonicida: VSAL_I0283Help
Entry
VSAL_I0283        CDS       T00782                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vsa  Aliivibrio salmonicida
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VSAL_I0283 (tpiA)
   01230 Biosynthesis of amino acids
    VSAL_I0283 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VSAL_I0283 (tpiA)
   00051 Fructose and mannose metabolism
    VSAL_I0283 (tpiA)
   00562 Inositol phosphate metabolism
    VSAL_I0283 (tpiA)
Enzymes [BR:vsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VSAL_I0283 (tpiA)
Exosome [BR:vsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VSAL_I0283 (tpiA)
  Exosomal proteins of bladder cancer cells
   VSAL_I0283 (tpiA)
  Exosomal proteins of melanoma cells
   VSAL_I0283 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(332081..332851)
Genome map
AA seq 256 aa AA seqDB search
MRHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFIDLAERTLTEAGSA
IILGAQNSDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHNESDEFVAKKFAFLKE
NGLTPVLCIGESDAQNEAGETMAVCARQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAA
TAEDAQRIHAQIRAHIAEKSEEVAKNVVIQYGGSVKPENAEAYFAQPDIDGALVGGAALD
AKSFAAIAKAAAKAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatcctgtagttatgggtaactggaaattaaacggcagcaaagaaatggttgtt
gatctattaaacggtcttaacgctgaacttgaaggcgttacaggtgtagacgttgcagtt
gctccaccagcactatttattgaccttgctgagcgtacgcttactgaagcgggcagcgcg
atcatcttaggtgctcaaaactctgacctaaacaacagcggtgcattcactggcgacatg
tctccagctatgctgaaagaatttggtgctactcacatcatcatcggtcactctgagcgt
cgtgaataccacaacgaatcagacgagtttgttgctaagaaattcgctttcctaaaagaa
aacggcctaacgcctgttctttgtatcggtgaatctgatgcacaaaacgaagctggcgaa
acaatggctgtttgtgcacgtcaacttgacgctgttatcaacactcaaggcgttgaagct
cttgaaggcgctatcatcgcttatgaaccaatctgggctatcggtactggtaaagcggct
acagctgaagatgcacaacgcattcacgctcaaatccgtgctcacattgctgagaaatca
gaagaagtagctaagaacgttgttatccaatacggcggttctgttaagcctgaaaacgct
gaagcttacttcgcacaaccagacatcgatggtgctctagttggcggcgcagcacttgac
gcgaaaagctttgcagctatcgctaaagcagcagctaaagcaaaagcttaa

DBGET integrated database retrieval system