KEGG   Aliivibrio salmonicida: VSAL_I0283Help
Entry
VSAL_I0283        CDS       T00782                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00010  Glycolysis / Gluconeogenesis
vsa00051  Fructose and mannose metabolism
vsa00562  Inositol phosphate metabolism
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01120  Microbial metabolism in diverse environments
vsa01130  Biosynthesis of antibiotics
vsa01200  Carbon metabolism
vsa01230  Biosynthesis of amino acids
Module
vsa_M00002  Glycolysis, core module involving three-carbon compounds
vsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VSAL_I0283 (tpiA)
   00051 Fructose and mannose metabolism
    VSAL_I0283 (tpiA)
   00562 Inositol phosphate metabolism
    VSAL_I0283 (tpiA)
Enzymes [BR:vsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VSAL_I0283 (tpiA)
Exosome [BR:vsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VSAL_I0283 (tpiA)
  Exosomal proteins of bladder cancer cells
   VSAL_I0283 (tpiA)
  Exosomal proteins of melanoma cells
   VSAL_I0283 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAQ77968
UniProt: B6EPI8
Position
1:complement(332081..332851)
Genome map
AA seq 256 aa AA seqDB search
MRHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFIDLAERTLTEAGSA
IILGAQNSDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHNESDEFVAKKFAFLKE
NGLTPVLCIGESDAQNEAGETMAVCARQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAA
TAEDAQRIHAQIRAHIAEKSEEVAKNVVIQYGGSVKPENAEAYFAQPDIDGALVGGAALD
AKSFAAIAKAAAKAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatcctgtagttatgggtaactggaaattaaacggcagcaaagaaatggttgtt
gatctattaaacggtcttaacgctgaacttgaaggcgttacaggtgtagacgttgcagtt
gctccaccagcactatttattgaccttgctgagcgtacgcttactgaagcgggcagcgcg
atcatcttaggtgctcaaaactctgacctaaacaacagcggtgcattcactggcgacatg
tctccagctatgctgaaagaatttggtgctactcacatcatcatcggtcactctgagcgt
cgtgaataccacaacgaatcagacgagtttgttgctaagaaattcgctttcctaaaagaa
aacggcctaacgcctgttctttgtatcggtgaatctgatgcacaaaacgaagctggcgaa
acaatggctgtttgtgcacgtcaacttgacgctgttatcaacactcaaggcgttgaagct
cttgaaggcgctatcatcgcttatgaaccaatctgggctatcggtactggtaaagcggct
acagctgaagatgcacaacgcattcacgctcaaatccgtgctcacattgctgagaaatca
gaagaagtagctaagaacgttgttatccaatacggcggttctgttaagcctgaaaacgct
gaagcttacttcgcacaaccagacatcgatggtgctctagttggcggcgcagcacttgac
gcgaaaagctttgcagctatcgctaaagcagcagctaaagcaaaagcttaa

DBGET integrated database retrieval system