KEGG   Aliivibrio salmonicida LFI1238: VSAL_I0366Help
Entry
VSAL_I0366        CDS       T00782                                 

Gene name
folA
Definition
dihydrofolate reductase type 3 (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vsa  Aliivibrio salmonicida LFI1238
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vsa00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:vsa00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:400556..401077
Genome map
AA seq 173 aa AA seqDB search
MKISMIAAMANNGKIDKSCNLSNSQSRIIGKNNQMPWHLPADFAWFKQCTMGKPIVMGRK
TYESIGRPLPGRLNIVLSRDASLKIEGVTCVTSIDEAKQVAGDIEELMIIGGGSIYQACL
PDADTLYLTFIDADIDGDTQFPDWGEGWNQTHSEMYLKDEKNQYDMEFVVLER
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaagattagtatgattgctgccatggcaaataatgggaaaatagataaatcgtgcaat
ctgtcaaattctcaatctcgaattattggcaaaaataatcaaatgccatggcatttacct
gctgattttgcatggtttaagcaatgtactatgggaaagccaattgtgatggggcgtaaa
acctatgaatccattggtcgtccattaccgggacgcttaaatattgtattaagccgtgat
gcgagtttgaagattgaaggtgtcacttgtgtgacttcaattgatgaagcgaagcaagtc
gccggtgatattgaagaactaatgattattggtggtggctctatctatcaagcgtgttta
cctgatgctgatactctttatcttacctttattgatgctgatattgatggagatactcaa
ttccctgattggggagaggggtggaaccagacgcattctgagatgtatttgaaagatgaa
aagaatcagtacgatatggaatttgtagtgttagaaaggtaa

DBGET integrated database retrieval system