KEGG   Aliivibrio salmonicida: VSAL_I0448Help
Entry
VSAL_I0448        CDS       T00782                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vsa  Aliivibrio salmonicida
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VSAL_I0448 (galU)
   00052 Galactose metabolism
    VSAL_I0448 (galU)
   00500 Starch and sucrose metabolism
    VSAL_I0448 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    VSAL_I0448 (galU)
Enzymes [BR:vsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VSAL_I0448 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(503682..504551)
Genome map
AA seq 289 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPIVNKPLIEYGVEEAINAGMDGICIVTGRGKH
SLMDHFDKNYELEHQISGTNKEELLEDVRELIDAAHFTYIRQREMKGLGHAILTGRELIG
DEPFAVVLADDLCVNEEQGVLSQMVALYKQFRCSIVAVEEVPDNETHKYGVIAGEMIKDD
LYRIDNMVEKPEPGTAPSNLAIIGRYILTPDIFEIIEQTEPGKGGEIQITDALLKQAQSG
CVLAYKFKGKRFDCGSVEGYIQATNYCYENVYLKDKKSAELAKQTTGKK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgtctttttcctgccgctggctacggtactcgttttcttcctgcgact
aaatctatgccaaaagaaatgatgccaatcgtaaataaaccgcttatagaatatggcgta
gaagaagctatcaatgcaggcatggacggaatatgcatcgtcactggccgtggtaagcat
tctttaatggatcactttgataaaaactacgagctagaacaccaaatcagtggcacaaat
aaagaagaacttcttgaagacgttcgtgaattaattgacgctgcacattttacttatatt
cgtcaaagagaaatgaaaggtttaggtcatgccattcttactggccgtgaactcatcggc
gatgaaccatttgctgtcgtacttgctgatgatttatgtgtcaatgaagaacaaggcgta
ctgtctcaaatggttgctttgtataagcaattccgttgttctatcgttgcagtagaagaa
gtacctgataacgaaacgcataaatacggcgttattgcaggtgaaatgatcaaagacgat
ctataccgcatagataacatggttgaaaaaccagaaccaggcactgcaccaagtaacctt
gcgatcattggtcgttacattctaacaccagatatctttgagattattgagcaaacagaa
ccaggtaaaggtggtgaaatccaaattaccgatgcgttattaaagcaagctcaatcaggt
tgtgttcttgcttataaatttaaaggtaagcgttttgactgtggtagcgttgaaggttat
atccaagcaacaaactactgctacgaaaatgtatatttaaaagataaaaaatcagctgaa
ttagcaaaacaaacaacaggtaaaaagtaa

DBGET integrated database retrieval system