KEGG   Aliivibrio salmonicida: VSAL_I0504Help
Entry
VSAL_I0504        CDS       T00782                                 

Definition
(GenBank) sodium/calcium exchanger protein
  KO
K07301  
cation:H+ antiporter
Organism
vsa  Aliivibrio salmonicida
Brite
Transporters [BR:vsa02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   VSAL_I0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(562544..563512)
Genome map
AA seq 322 aa AA seqDB search
MTELLMPSLLLVVGLSLLVWGADKLVFGSAALAKNYGISPLVIGMTILAMGSSAPEMMVS
AAAALDGKTDTAVGNVIGSNIANIALILGITALIKPLAISSGIIRRELPLMLIVTLLAGG
IMYDNYLGFNEGILLVALFIAFILAMLYISRKEQPNGDTLLNEQESEIPDGVPNGKAIFW
VVVGLALLPLGANMLIDNAVIIAKHFGMSDLVIGLTIIAIGTSLPELAASVAGVLKGEDD
MAVGNIIGSNVFNILAVMGIPALLHPSSISEYIMSRDFYVMLGVSVLLLIMALGKSRSIN
RIEGGILVTCFLIYQGFLFYTM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacagagctgcttatgccatctctacttcttgtcgtaggactctctttacttgtttgg
ggcgccgataaattggtatttggttctgccgcattagcgaagaactatggtatctctccc
cttgtcattggtatgactatattagcgatgggttcatctgccccagaaatgatggtttct
gctgctgccgccttagatggaaaaacagataccgctgttggtaatgtcattggctctaac
atcgctaacatcgcattaattttaggtattactgccttaattaaaccactagccattagc
tctggcatcattcgccgtgaactacctctgatgttgatcgtaacattgctggctggtggc
atcatgtatgataactacctaggatttaatgaaggcattttacttgttgctcttttcatc
gcttttattcttgcgatgttatatatcagccgaaaagaacaacccaatggtgacacgcta
cttaatgaacaagaatcagagatccctgatggtgttcctaacggaaaagcaattttctgg
gtggtagttggccttgcactgttaccattaggcgcaaatatgctgattgataacgcggtt
attattgcaaaacattttggtatgagtgatttagttattggtttaacaattattgctatc
ggaacaagtcttcctgaacttgccgcatctgttgcgggtgtattgaaaggcgaagatgac
atggctgttggtaatattattggttctaacgtattcaatattcttgccgttatggggatc
cctgcacttctacacccatcaagtatcagtgaatatattatgagccgtgacttctacgta
atgttaggcgtttctgttttacttcttattatggcgttgggtaaaagtcgcagcattaac
cgtattgaaggtggtattttagtgacgtgtttccttatatatcaaggattccttttctac
acgatgtaa

DBGET integrated database retrieval system