KEGG   Aliivibrio salmonicida LFI1238: VSAL_I0511Help
Entry
VSAL_I0511        CDS       T00782                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vsa  Aliivibrio salmonicida LFI1238
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vsa00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vsa00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:567032..568300
Genome map
AA seq 422 aa AA seqDB search
MYKFRIQGSDKPLSGEVTISGAKNAALPILFAALLAEEPVEVANVPKLRDVDTTIELLQR
LGAKVSRNGSVHIDASEVNNFCAPYDLVKTMRASIWALGPLVARFGKGQVSLPGGCAIGA
RPVDLHIHGLEQLGATIKLEDGYVKAEVDGRLKGAHIVMDKVSVGATITVMCAATLAEGT
TILENAAREPEIVDTAHFLNAIGAKVSGMGTDTITIEGVERLGGGYHEVVADRIETGTFL
VAAAVSGGKVVCKNTKASLLESVLAKLEEAGAKVESGEDWISLDMTGRELKAVNIRTAPH
PAFPTDMQAQFTLLNMMAKGPGIITETIFENRFMHIPELQRMGAHAEIEGNTAICGDTDG
LSGAQVMATDLRASASLVIAGCIAKGETIVDRIYHIDRGYDKIEDKLTALGANIERVRSS
EL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtataagttccgaattcaaggaagcgataaaccactttcaggagaggttacgatttct
ggtgcaaaaaatgctgcactaccaattttattcgctgcattacttgctgaagagccagta
gaagttgccaatgttcctaaacttcgtgatgttgatacaacgatagagttactgcaacgc
ttaggcgctaaggtttctcgtaatggttcagttcatattgatgcaagcgaagttaataac
ttttgtgcaccgtatgatttagttaaaacgatgcgtgcatcaatttgggcactcggtcca
ttggttgcacgttttggtaaaggccaagtatctttacctggtggttgtgctattggtgct
cgtcctgttgaccttcatattcacggtcttgagcaactgggtgcaactattaagcttgaa
gacggttacgttaaagctgaagttgatggccgcttaaaaggcgcacacatcgttatggat
aaagtcagtgttggcgcaaccatcacggttatgtgtgcagcgactttggctgaaggcacg
actattttagaaaacgcagcgcgtgaacctgagattgtagatactgctcatttccttaat
gctattggtgcgaaagtatcaggtatgggaaccgatacgattactattgaaggcgttgaa
cgtcttggtggtggatatcatgaagtggttgctgaccgtatagaaacggggacattcctt
gtcgcagctgctgtatctggcggtaaagtcgtatgtaaaaatacgaaagcgagcctactt
gaatctgttttggctaagcttgaagaagcgggcgctaaagttgaatctggtgaagactgg
atcagtttagacatgacaggccgagagctaaaagcggtaaatatccgtacggctccacat
cctgcatttccaacagacatgcaagcgcaattcacattgttaaatatgatggcgaaaggt
ccaggtattattacggaaacgatttttgaaaaccgtttcatgcacattcctgaattgcaa
cgtatgggtgctcacgctgagattgaaggtaatactgctatttgtggtgatactgatggt
ttaagtggtgctcaagtaatggcaacagatttaagagcctctgcaagccttgttatcgca
ggttgtatagcaaaaggtgaaacaattgttgatcgtatttatcatatcgaccgtggttat
gataagatcgaagacaagttaaccgcattaggcgcgaatatcgaaagagttcgtagtagc
gaattataa

DBGET integrated database retrieval system