KEGG   Aliivibrio salmonicida: VSAL_I0511Help
Entry
VSAL_I0511        CDS       T00782                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vsa  Aliivibrio salmonicida
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VSAL_I0511 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VSAL_I0511 (murA)
Enzymes [BR:vsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     VSAL_I0511 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:567032..568300
Genome map
AA seq 422 aa AA seqDB search
MYKFRIQGSDKPLSGEVTISGAKNAALPILFAALLAEEPVEVANVPKLRDVDTTIELLQR
LGAKVSRNGSVHIDASEVNNFCAPYDLVKTMRASIWALGPLVARFGKGQVSLPGGCAIGA
RPVDLHIHGLEQLGATIKLEDGYVKAEVDGRLKGAHIVMDKVSVGATITVMCAATLAEGT
TILENAAREPEIVDTAHFLNAIGAKVSGMGTDTITIEGVERLGGGYHEVVADRIETGTFL
VAAAVSGGKVVCKNTKASLLESVLAKLEEAGAKVESGEDWISLDMTGRELKAVNIRTAPH
PAFPTDMQAQFTLLNMMAKGPGIITETIFENRFMHIPELQRMGAHAEIEGNTAICGDTDG
LSGAQVMATDLRASASLVIAGCIAKGETIVDRIYHIDRGYDKIEDKLTALGANIERVRSS
EL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtataagttccgaattcaaggaagcgataaaccactttcaggagaggttacgatttct
ggtgcaaaaaatgctgcactaccaattttattcgctgcattacttgctgaagagccagta
gaagttgccaatgttcctaaacttcgtgatgttgatacaacgatagagttactgcaacgc
ttaggcgctaaggtttctcgtaatggttcagttcatattgatgcaagcgaagttaataac
ttttgtgcaccgtatgatttagttaaaacgatgcgtgcatcaatttgggcactcggtcca
ttggttgcacgttttggtaaaggccaagtatctttacctggtggttgtgctattggtgct
cgtcctgttgaccttcatattcacggtcttgagcaactgggtgcaactattaagcttgaa
gacggttacgttaaagctgaagttgatggccgcttaaaaggcgcacacatcgttatggat
aaagtcagtgttggcgcaaccatcacggttatgtgtgcagcgactttggctgaaggcacg
actattttagaaaacgcagcgcgtgaacctgagattgtagatactgctcatttccttaat
gctattggtgcgaaagtatcaggtatgggaaccgatacgattactattgaaggcgttgaa
cgtcttggtggtggatatcatgaagtggttgctgaccgtatagaaacggggacattcctt
gtcgcagctgctgtatctggcggtaaagtcgtatgtaaaaatacgaaagcgagcctactt
gaatctgttttggctaagcttgaagaagcgggcgctaaagttgaatctggtgaagactgg
atcagtttagacatgacaggccgagagctaaaagcggtaaatatccgtacggctccacat
cctgcatttccaacagacatgcaagcgcaattcacattgttaaatatgatggcgaaaggt
ccaggtattattacggaaacgatttttgaaaaccgtttcatgcacattcctgaattgcaa
cgtatgggtgctcacgctgagattgaaggtaatactgctatttgtggtgatactgatggt
ttaagtggtgctcaagtaatggcaacagatttaagagcctctgcaagccttgttatcgca
ggttgtatagcaaaaggtgaaacaattgttgatcgtatttatcatatcgaccgtggttat
gataagatcgaagacaagttaaccgcattaggcgcgaatatcgaaagagttcgtagtagc
gaattataa

DBGET integrated database retrieval system