KEGG   Aliivibrio salmonicida: VSAL_I0563Help
Entry
VSAL_I0563        CDS       T00782                                 

Gene name
dsbC
Definition
thiol/disulfide interchange protein DsbC precursor
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vsa  Aliivibrio salmonicida
Brite
Enzymes [BR:vsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VSAL_I0563 (dsbC)
Secretion system [BR:vsa02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VSAL_I0563 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:617137..617913
Genome map
AA seq 258 aa AA seqDB search
MSFIRRTSAMIIALLSVASFTACSDEQVKETATPASPVVASNSDSTIAITQRLTTLGLPV
EAIHDSDIDGFKQVETPFGIFYVSDDGKHFIQGRIFEFDENGNMKDLLAARFAKLVDSQS
ENMIVFPAKNEKYVITVFTDITCGYCTKLHKEMKDYNDAGITVRYLAYPRQGYQGSVADK
MAQVWCADDKQQAMEDAKSNRPINGSKPATAQCKNIIKEQYLLGRKMGVNGTPAIVLPNG
DLVPGYKPAKELLADLEK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttattcgccgtactagcgcaatgattattgctctattgagcgtcgcttctttt
actgcttgttctgatgagcaagtaaaagaaactgcaacaccggcttctcctgtagtggca
tctaatagtgattcaacaattgcgattactcaacgattaacgacattaggtttacctgtt
gaagccattcatgattctgatattgatggcttcaaacaagttgaaaccccatttggtatt
ttttacgtctctgatgacggtaagcactttattcaaggtcgaatttttgagtttgatgaa
aatggcaatatgaaagatttgttagcggctcgtttcgctaagctagtcgatagccaaagt
gagaacatgatcgtgttccctgcaaaaaacgaaaagtatgtgattaccgtctttaccgac
atcacctgtggttactgtacaaaactgcataaagagatgaaagattataatgatgcagga
attacggttcgttatttagcgtatcctcgtcagggctaccaaggttcagttgccgataaa
atggcgcaagtttggtgtgctgatgataaacagcaagcgatggaagatgcgaaatcgaat
cgcccaataaatggttcaaaacccgcgactgctcagtgtaaaaatatcattaaagagcaa
tatcttttaggtcgtaaaatgggtgtaaatggcactccagctattgttttacctaatggc
gatttagttcctggttacaaacctgcgaaagaattgcttgccgatttagaaaaataa

DBGET integrated database retrieval system