KEGG   Aliivibrio salmonicida LFI1238: VSAL_I0593Help
Entry
VSAL_I0593        CDS       T00782                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
vsa  Aliivibrio salmonicida LFI1238
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vsa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:654843..655676
Genome map
AA seq 277 aa AA seqDB search
MKLISKEKTLILDRSHVMGILNVTPDSFSDGGKFTDLEAALRQVEKMVNAGVSFIDIGGE
STRPGAPEVGVQQELDRVIPIIEAIHQRFDTWISIDTSKAVVMDEAVKFGADLINDVRAL
QEPNALEVAAKANVPICLMHMQGQPRTMQSNPTYENVFSDVSLFLEERIAACQSIGITKD
KLILDPGFGFGKSLAHNYQLLTELERFHQFGLPILAGMSRKSMIFKLLDIEPQEAISGSL
ACATIAAMKGAQIIRVHDFEQTMDIVKVCQATLEQAS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgataagcaaagagaagacgttaatattagatcgctctcatgtaatggggatc
cttaatgtgacgcctgattctttttctgatggtggtaaatttactgatttagaggctgct
ttaaggcaagttgaaaaaatggtaaatgctggtgttagctttattgatattggtggtgag
tcaaccagaccaggcgcacctgaggttggggttcagcaagaattggatcgggtgattccg
atcattgaggctattcatcagcgatttgatacatggatatcaattgataccagtaaagcg
gtcgtaatggatgaagccgtaaagtttggtgcagatttaattaatgatgtgcgggcatta
caagagcctaatgcgctagaggttgcggcaaaagcgaatgtaccaatttgcttgatgcat
atgcaaggtcaaccaagaacgatgcaatcaaaccctacttatgaaaacgtattttcagat
gtttctctttttttagaagaaagaatagcggcttgccaatcgattggtatcacaaaagat
aaattaattctcgatcctgggtttggatttgggaaaagcttggcgcataattaccaatta
cttactgaattagaacgtttccatcaatttgggcttcctatattggcgggaatgtctcgt
aaatcaatgatttttaaattgctggatattgagccccaggaggctatttctggaagcttg
gcgtgcgcgactattgcagcaatgaaaggcgcgcaaattatccgagttcatgattttgaa
caaacaatggatattgtgaaagtttgccaagcaacattggagcaagcttcttag

DBGET integrated database retrieval system