KEGG   Aliivibrio salmonicida: VSAL_I0611Help
Entry
VSAL_I0611        CDS       T00782                                 

Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vsa  Aliivibrio salmonicida
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VSAL_I0611
   00240 Pyrimidine metabolism
    VSAL_I0611
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VSAL_I0611
   03430 Mismatch repair
    VSAL_I0611
   03440 Homologous recombination
    VSAL_I0611
Enzymes [BR:vsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VSAL_I0611
DNA replication proteins [BR:vsa03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VSAL_I0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:674232..674633
Genome map
AA seq 133 aa AA seqDB search
MPKQALQFLNEMDISVWQIRHAEYFPTLETSTISLPETCQLLFIAESIPTERDAYLFGKV
LASMKLKPEQALFLSSESLEYVAEHHLNWCWFSGVPVTELEGVQILNSPLLSEMHTNTQL
RRDLWRQICSYDN
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacaagcgttacagtttttgaatgagatggatatttctgtttggcagatccgc
cacgctgaatattttcctacattagaaacaagcactatttcattacctgaaacgtgtcag
ttactttttattgctgaatcaattcctacagagcgtgatgcttatttatttggcaaagta
cttgcgagtatgaagctgaaacctgaacaggcgttatttctttcttccgagtcgttagag
tatgtggctgaacaccatttaaattggtgttggttctctggtgtgcctgttactgaattg
gaaggagttcagatactgaattctcctcttttatctgaaatgcatacaaatactcaatta
cgacgcgacctatggcgacaaatttgttcttatgacaattaa

DBGET integrated database retrieval system