KEGG   Aliivibrio salmonicida: VSAL_I0620Help
Entry
VSAL_I0620        CDS       T00782                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vsa  Aliivibrio salmonicida
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VSAL_I0620 (deoA)
Enzymes [BR:vsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VSAL_I0620 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:682400..683731
Genome map
AA seq 443 aa AA seqDB search
MYLPQEIIRRKRDNKVLTTEEINFFIQGVAKNTVSEGQIAAFAMAVYFNEMTMPERIALT
CAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIAGYNIMPNNDLFGKVTKEAGVAIIGQTGDLAPADKRVYATRDVTATVDNI
SLITASILSKKLAAGLDSLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTALLT
DMNQVLASTAGNALEVREAIRFLTGEYRNPRLYEVAMALCAEMLVIANLAKDEQEACIKL
QAVLDNGKAAECFGKMVFGLGGPNDIIENYDNHLETAQIIKPVFADKSGFVNTMDTRDLG
MAVVGMGGGRRVASDTIDYAVGLSDMIRLGQTVDSNQPLAMIHARNEDQWQQAADAVKAA
IVISEEQPEATPEVYRKVRSQDV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtatctaccacaagagattattcgtagaaaacgcgacaataaagtactaacaacagaa
gaaattaacttttttattcaaggtgttgcaaaaaataccgtgtctgaaggtcaaattgca
gcatttgcaatggcggtatattttaatgaaatgacgatgcctgaacgtattgcattaacg
tgtgcaatgcgtgattcaggaatggtaattgattggagccatatgaacttcgatggccca
attgttgataaacattcaaccggtggtgttggtgatgtaacctcattaatgcttggtcct
atggtggcggcatgtggtggttatgttcctatgatctctggccgtggtttaggtcatact
ggtggcacgttagataaattggaatccattgctggctacaatattatgccaaacaatgat
ctttttggaaaagtaaccaaagaagctggcgtagctatcattggtcaaacgggtgattta
gcaccggcagataagcgtgtttatgccactcgtgatgtaacggcaaccgttgataatatt
tcattgattactgcatctattctttctaagaaattagccgcaggtttagattcattagtg
atggatgtaaaagtcggttcaggtgcatttatgccgacttatgaggcatcagaagagctg
gctaaatctatcgtagctgttgctaatggcgcgggcacgaagacgaccgcattactgacg
gacatgaatcaagtattagcctctactgcgggtaatgcattagaagttcgtgaagcgatt
cgtttcctaactggcgaataccgtaatcctcgtttatatgaagttgcgatggcgctatgt
gctgaaatgcttgtgattgcgaacttagcaaaagacgaacaagaagcgtgtattaaattg
caagcagtgttagacaacggcaaagccgcagaatgttttggtaaaatggtgtttggtctt
ggtggaccaaatgacattatcgaaaattacgataaccatttagaaaccgcgcaaatcatt
aaacctgtatttgcagacaaatccggctttgttaatacgatggatacgcgtgatttaggc
atggcagtcgttggtatggggggcggtcgtcgtgttgctagcgatactattgattatgcg
gttgggttaagtgatatgattcgtttaggtcaaaccgttgatagcaatcaaccattagcg
atgatccatgctcgtaatgaagatcaatggcagcaggctgcagatgcagttaaagccgct
atcgtgatcagcgaagaacaaccagaagcgacaccggaagtttatcgtaaagttcgctca
caagatgtgtaa

DBGET integrated database retrieval system