KEGG   Aliivibrio salmonicida LFI1238: VSAL_I0682Help
Entry
VSAL_I0682        CDS       T00782                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vsa  Aliivibrio salmonicida LFI1238
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vsa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:764777..766801
Genome map
AA seq 674 aa AA seqDB search
MLKQLQHLMAHGVLRPLDLQFAKFLGQQEKNSDKNLIMLLAAMTSHELGKGHVCIDIEQV
EQGDLFTLPAKYRDALLALVPEKNQWISELSAASTISNGTEATPLAFDGTRLYLQRYWSF
EQRVANRITKAAQSVAVNAQLSNTLDELFARQYHFLFSGLKKLENNNQVSRQQLVCDMLD
VVGSSSSELDWQAIDGVLLSATKSSELEPLDNLIPTKHCVNWQKVAAAVALTRRFSVISG
GPGTGKTTTVTKLLASLVTQAQQDNKSIAIKLVAPTGKAAARLTESIGQAVQSIGLAPEV
KEAIPTDASTLHRLLGYIPNQVDFRHNKSNPLHLDVLVVDEASMVDLPMMARLLDAVPEH
ARVILLGDKDQLASVEAGAVLGDICQFTKMGYSQNQAQQLSQLTGYALPVQSHNNAVADS
LCMLQKSYRFDARSGIGQLAKAINEGCKFKVEAVWAKGFSDIRFHDLSNDSYNAMITMMV
NGYRSYLGHIHAGDKPEVALKAFSQIQLLCAMREGDFGVVGLNQRIEKGLRKSDLIPHGD
EVWYSGRPVMVTQNDYGVGLYNGDIGIAMPDPVDQRLRVYFDMPDGSIRGVLPSQLPEHE
TVYAMTIHKSQGSEFEHTVLALPAEFSPILTRELIYTGVTRAKKKLDLFATEKVVARGVM
IKTQRNSGLAALMS
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagcaattacaacacttaatggctcatggtgtacttcgcccattggatcttcaa
tttgctaagtttttaggccaacaggaaaagaacagcgataaaaacttaatcatgttgctc
gcagcaatgactagccatgagttaggtaaaggccatgtgtgtattgatatcgagcaagta
gagcaaggtgatctgtttacgttgcctgcaaaatatcgtgatgcattgttagcgttagta
ccagagaaaaatcagtggattagtgagttatctgcggcatcgacgatatctaatggcaca
gaagcaacgccactagcctttgatggaactcgtttgtatttacaacgttattggtcgttt
gaacagcgtgttgccaaccgtataactaaagcggcgcaaagtgtggcggtaaacgctcag
ttatcgaatacattggatgagctatttgctcgccaataccattttttattcagtgggctt
aaaaaattagagaataataatcaagtatctcgtcagcaattagtgtgcgatatgctcgat
gttgtgggatctagttctagtgagttagattggcaagcgattgatggggttttactctca
gccactaagtcttcagaattagagccgctggataacttaatcccaaccaaacactgtgtg
aattggcagaaagttgcggcagcggtagcgttaactcgtcgattctcggtgatctctggt
ggtccaggaacgggtaaaacaaccacggttaccaagcttttggcttccctagtgactcaa
gctcagcaagataataaaagcatcgcaattaagttagttgctccaacgggtaaagcggca
gcgcgtttgactgaatccattggtcaagcggtgcaatctattggtttagcaccagaagta
aaagaagcgatcccgacagacgcaagtacgctgcatcgcttgcttggttatattccaaac
caagtggattttcgtcataacaaaagcaatccattacaccttgatgtattggtggtggat
gaagcctcgatggtcgatttacctatgatggcccgactactcgatgcggtaccagaacac
gcgcgtgttattttattgggcgataaagatcagctagcctcggttgaagcgggagcggtg
ttaggtgatatctgtcaatttactaaaatgggttacagccagaatcaagcacaacaatta
tctcaattaacaggctatgctttgcctgtgcaatcgcacaataacgcggtcgccgatagc
ttgtgtatgctgcaaaagagttaccgttttgatgcgcgctcagggattggacaattagct
aaagccattaatgaaggctgtaaatttaaagtagaagcggtgtgggccaaagggttctct
gatattcgttttcatgatttaagtaatgacagctataacgcaatgatcaccatgatggtg
aatggctatcgcagttatttaggtcatatccatgcgggcgataaaccagaagtggcacta
aaagcctttagccaaattcaattattgtgtgcaatgcgcgaaggggactttggggttgta
ggacttaatcaacgaattgaaaaaggattaagaaaatctgatttgattcctcatggtgat
gaagtgtggtattccggtcgcccggtgatggtgactcaaaatgattatggcgtaggtctt
tataatggtgatattggtattgcgatgccagatcctgttgatcaacgtttacgtgtttat
tttgatatgccagatggttcgattcgtggagtattaccaagtcaattaccagagcatgaa
accgtgtatgcgatgacgattcataaatctcaagggtctgagtttgaacatacagtttta
gctttacctgctgagttcagcccaatcttaacgcgagagttgatttatacgggtgtcaca
cgagctaagaaaaaactcgatctgttcgcaacagagaaagtggtggcgagaggtgtaatg
attaaaactcagagaaacagtggattagctgcgttgatgagctaa

DBGET integrated database retrieval system