KEGG   Aliivibrio salmonicida: VSAL_I0705Help
Entry
VSAL_I0705        CDS       T00782                                 

Gene name
pbgA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vsa  Aliivibrio salmonicida
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VSAL_I0705 (pbgA)
Enzymes [BR:vsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     VSAL_I0705 (pbgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:791836..793245
Genome map
AA seq 469 aa AA seqDB search
MKFANDFLLGAATASYQIEGAWDQDGKGPTNWDEFTKIPGKTFEGTNGDIAIDHYNRYKE
DIALMAEMGLESYRFSISWARIFPNGTGEINQKGIDFYNNVIDECLKYGIVPFVTLYHWD
LPLTLEKEGSWLNKATCDAYVEFAKLCFNEFGDRVKHFITFNETVVFCALGYMAGAHPPG
IQNDPKKYFQATHNVFYAHAKAVIEYKKLNQFGEIGLSHVFSPAFGVDDSEASHFAAIHA
NQFSMNWFYDPILLGKYPEYVVKQLQEEGNLPDWTDEELQTIFEAAPLNDFMGLNYYQPQ
RVEKIESGMEIRKITRENSTGSPGNPSYDNVYRTVKMDDKKYTKWDWEISPEGFVAGLEM
IKEHYGQIKLYITENGLGDEDPIIDGEVCDIPRINFIKDHLGAVKEAVRRGVHIKGYYAW
SAIDLLSWLNGYKKQYGFIYVDHQNGLERKKKASFHWFKDVIATRGENI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcaaatgattttttattaggcgcagcaacggcttcttaccaaatagaaggc
gcatgggatcaagatggaaaaggtccaacaaactgggatgagtttactaaaattccaggg
aaaacctttgaaggaactaatggcgacatcgcaattgatcattataatcgctataaagaa
gacatcgcattaatggctgaaatgggcttagagtcttatcgcttttcaatatcttgggct
cgtatttttccaaatggcaccggagagattaatcaaaaaggaatcgacttttacaataat
gtcattgatgaatgcttgaaatatggcatcgttccttttgttaccttatatcactgggat
ctacctcttacgttagaaaaagaaggttcatggttaaataaagccacctgtgatgcgtat
gttgaatttgcaaagttatgttttaatgaatttggagatcgtgttaaacatttcattact
tttaatgaaaccgttgtgttttgcgcattaggctatatggcaggcgcacacccaccaggg
attcaaaatgatcctaagaaatattttcaagcgacgcacaacgtattttatgcacacgct
aaagccgtcattgagtataaaaaactgaatcaatttggtgagattggcttgagtcatgta
tttagccctgcatttggggtcgatgattcagaggcgagtcactttgccgcaatacatgcg
aaccaatttagtatgaattggttctatgatcctatcctattaggtaagtatcctgaatac
gtggttaagcaactacaagaagaaggtaacttgcccgattggactgatgaagaactacaa
actatttttgaagccgcaccgttgaatgactttatgggactgaattactaccaaccacaa
cgtgttgaaaaaattgaaagtggtatggaaattcgtaaaatcactcgtgaaaattcgact
ggttctccgggcaacccaagttacgataatgtatatcgcacagttaaaatggacgataaa
aaatacactaaatgggattgggaaatttcacctgaagggtttgttgctgggcttgaaatg
ataaaagagcattatggtcagatcaaactgtacattacagaaaatggattgggtgatgaa
gatccgattattgatggtgaagtgtgtgatattccgcgaatcaattttattaaagatcat
ctaggtgcagtaaaagaagcggttcgtcgtggtgttcacattaaggggtattacgcatgg
tcagcgattgatttattgagctggttaaacggttacaaaaagcaatatgggttcatttat
gttgatcatcaaaatggactagagcgtaagaaaaaagcgtctttccattggtttaaagat
gttatcgcgactcgtggtgaaaatatctag

DBGET integrated database retrieval system