KEGG   Aliivibrio salmonicida LFI1238: VSAL_I0847Help
Entry
VSAL_I0847        CDS       T00782                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vsa  Aliivibrio salmonicida LFI1238
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:vsa01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:vsa00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:vsa00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:943461..944672
Genome map
AA seq 403 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKPGDTVERDEILVDIETDKVVLEVPAPEAGVLEAIF
EDEGATVLSKQLLAKIKLGAVVGEPTKDVTNETESSPDKRHTASLAEEKNDALSPAVRRL
LGEHDIKASDVKGTGVGGRITREDVDAHVAALKATSAKATVSNEPAAPLAHRSQKRVPMT
RLRKTVARRLLEAKNSTAMLTTFNEVNMKPIMELRKQYQEQFEKRHGTRLGFMSFYVKAV
TEALKRYPEVNASIDGDDIIYHNYFDISMAVSTPRGLVTPVLKDCDALGFADIEKGIKEL
AIKGRDGKLAVEDLIGGNFTITNGGVFGSLMSTPIINPPQAAILGMHKIQDRPMAVNGKV
EILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARLLLDV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattctggttccagatttacctgaatctgtagcagacgctactgtagct
acatggcataaaaaacctggtgatacagttgagcgtgatgaaatacttgtagatattgaa
acagataaagtggttcttgaagtaccggctcctgaagctggtgtactcgaagctattttt
gaagatgaaggtgcgacggttctttctaaacagttgcttgctaaaatcaaactaggtgca
gttgttggtgagccaacaaaagatgtgacgaatgagacggagtcttctcctgataaacgt
cacaccgcatcgttagcagaagagaaaaatgacgcattaagccctgcggtacgtcgttta
cttggtgagcatgacattaaagcatcagatgtaaaaggcactggtgttggtggtcgaatt
actcgtgaagatgttgatgcacatgttgcagcattaaaagcaacatcagcaaaagccacg
gtatctaatgagccagctgcgccattagctcatcgtagccaaaagcgcgtaccaatgact
cgtcttcgtaaaacagtagcaagacgtttattggaagcgaaaaacagcacggcaatgcta
acgacgtttaatgaagtaaacatgaaaccaatcatggaacttcgtaagcagtatcaagag
cagtttgaaaagcgtcacggcactcgtttaggtttcatgtctttctatgtgaaagcggta
actgaagcacttaaacgctaccctgaagtgaacgcatccattgatggtgatgatattatt
tatcataactattttgatattagtatggcggtatctacgccacgtggtttagtgactcca
gtactaaaagactgtgatgcacttggttttgccgatattgaaaaaggcattaaagaactg
gcgattaaaggccgtgatggaaaactagcggttgaagatttaatcggtggtaactttact
atcactaatggtggtgtgtttggttcgcttatgtcgacaccaattattaacccaccacaa
gcggcaattttaggtatgcataaaatccaagaccgtccaatggctgtcaatggaaaagta
gaaattctaccaatgatgtaccttgcactctcttatgatcaccgtctaatcgatggtcgt
gaatcagtaggtttccttgtaacgattaaagagttacttgaagatcctgctcgcttacta
ctagacgtttag

DBGET integrated database retrieval system