KEGG   Aliivibrio salmonicida: VSAL_I0848Help
Entry
VSAL_I0848        CDS       T00782                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00020  Citrate cycle (TCA cycle)
vsa00640  Propanoate metabolism
vsa00660  C5-Branched dibasic acid metabolism
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01120  Microbial metabolism in diverse environments
vsa01130  Biosynthesis of antibiotics
vsa01200  Carbon metabolism
Module
vsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VSAL_I0848 (sucC)
   00640 Propanoate metabolism
    VSAL_I0848 (sucC)
   00660 C5-Branched dibasic acid metabolism
    VSAL_I0848 (sucC)
Enzymes [BR:vsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VSAL_I0848 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: CAQ78533
UniProt: B6EHV6
Position
1:944824..945990
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEYGLPVPEGYACDTAQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKEFAQKWLGKNLVTFQTDAKGQPVTKVLVEEASNIANELYLGAVVDRATRR
IVFMASTEGGVDIEKIAEETPELIHQAAIDPLVGPQAFQGRELAFKLGLEGDQIKQFVKI
FLGLGNMFAQYDLALLEINPLVVTAEGNLLCLDGKINIDSNAMYRQPKLREMHDPSQEDE
REAHAAQWELNYVALDGSIGCMVNGAGLAMGTMDIVNLHGGQPANFLDVGGGATKERVTE
AFKIILSDSNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVKVPVVVRLEGNNAPLGSQK
LAESGLNIIAATSLTEAAEKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacatgaatatcaagcaaagcaactctttgcagaatacggccttcctgtacct
gaaggttatgcttgtgataccgctcaagaggcttttgaagctgctggacgtattagcact
gcgaaaaaagtggttaagtgtcaagtccacgctggtggtcgcggtaaagcgggcggtgtt
gaactgcatgacacaaaagaaggcgttaaagaattcgctcaaaagtggttaggtaaaaac
ctagtgactttccaaacagacgctaagggtcaaccagtcacaaaagtattggttgaagaa
gcgtcaaatattgcaaatgaattatacctaggtgcggttgttgaccgtgctacgcgtcgt
atcgtgttcatggcatcgactgaaggtggtgtggatattgagaagattgctgaagaaact
ccagagttaattcaccaagcggcgattgatccattagttggtcctcaagctttccaaggc
cgtgaattagcctttaaacttggtcttgaaggcgatcaaattaagcaattcgttaagatc
tttctaggtcttggcaacatgtttgctcagtatgatttagcgctacttgaaattaaccca
cttgtggtgacggcagaaggtaaccttctgtgtttagatggtaaaattaacattgattct
aatgctatgtaccgtcaaccaaaactgcgtgaaatgcatgatccatctcaagaagatgag
cgcgaagcacatgcagcacaatgggaattaaactacgttgccctagatggtagcattggt
tgtatggtaaatggtgcaggccttgctatgggcacaatggatatcgtgaatctacacggt
ggccaacctgctaacttcctagatgttggcggcggtgcaacaaaagaacgtgtaacagaa
gcctttaagatcatcttatcagacagcaatgtaaaagcggttttggttaacatctttggt
ggtattgttcgctgtgaccttattgctgatggcattattggtgcggttgaagaagtgggt
gtaaaagtgcctgttgttgttcgccttgaaggtaataacgcaccactagggtcacaaaaa
ctggctgaaagtggcctaaatatcattgcggctacttcattaactgaagcagctgaaaaa
gttgttgctgctgcggagggcaaataa

DBGET integrated database retrieval system