KEGG   Aliivibrio salmonicida: VSAL_I1149Help
Entry
VSAL_I1149        CDS       T00782                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vsa  Aliivibrio salmonicida
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VSAL_I1149 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VSAL_I1149 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VSAL_I1149 (trpA)
Enzymes [BR:vsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VSAL_I1149 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1249890..1250696)
Genome map
AA seq 268 aa AA seqDB search
MDRYQALFAKLAEKNQGAFVPFVTIGDPNPELSYEIMDTLVKAGADALELGIPFSDPLAD
GPTIQGANIRALNSKTTPIVCFDLIAKIRAKYPETPIGLLVYANLVFANGIDTFYTKCQQ
AGVDSVLIADVPTNESEEFRTSAIKHNVHPIFIAPPSASDETLETVAKLGGGYTYLLSRA
GVTGAETKAGMPVAQLLARLNQFDAPPAILGFGISEPAQVEEAIKAGAAGAISGSATVKI
IEQHQDNPAALLDALTAFTSAMKAATQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttatcaagccctatttgctaaattagcagaaaaaaaccaaggtgcatttgtt
ccttttgtaaccattggcgatccaaatccagaactttcttatgaaatcatggatacttta
gtaaaagcaggtgccgatgcacttgaacttggtatcccattctctgatcctttggctgat
ggaccaacaattcaaggtgcaaatattcgtgcattaaacagtaaaacaacgcctatcgta
tgttttgatttaatcgcaaaaatccgagctaaatatcctgaaaccccaattggcctatta
gtttacgccaaccttgtcttcgcaaatggcattgatactttctatactaaatgtcagcaa
gctggtgtagattcagtgttaattgcagacgtaccaaccaatgaatcagaagagtttaga
acaagtgcaattaaacacaatgttcaccctatcttcattgcgcctccgtcagcctcagat
gaaacattagaaaccgttgctaagcttggtgggggttatacttaccttctttctcgtgca
ggtgttactggtgctgaaactaaagcgggcatgcctgttgctcaattattagcacgttta
aaccaatttgatgcacctcctgcgattcttggttttggtatatcggaacctgctcaagta
gaagaagcgattaaagccggtgcagcaggcgcaatttcaggctctgcaactgttaaaatc
attgaacaacatcaagacaatccagcggcgttacttgatgcacttacggcatttacttct
gccatgaaagcagcaacacaaaaataa

DBGET integrated database retrieval system