KEGG   Aliivibrio salmonicida: VSAL_I1150Help
Entry
VSAL_I1150        CDS       T00782                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain 1
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vsa  Aliivibrio salmonicida
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VSAL_I1150 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VSAL_I1150 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VSAL_I1150 (trpB)
Enzymes [BR:vsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VSAL_I1150 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1250696..1251886)
Genome map
AA seq 396 aa AA seqDB search
MAKLDAYFGEYGGQYVPQILVPALDQLEQAFIDAQADEDFRAEFMTLLQEYAGRPTALTL
CRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLALRMGKKEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDIERQSPNVFRMELMGAEVIPVHSGSATLKDACNEALRDWSATY
ETAHYLLGTAAGPHPFPTIVREFQRMIGEETKMQILAREGRLPDAVIACVGGGSNAIGMF
ADFIKEENVRLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDEHGQIEESYSVS
AGLDFPSVGPQHAHLNSIGRAEYGSVTDDEALEAFQILAKGEGIIPALESSHALAYALQM
AHSEPEKEQLLVVNLSGRGDKDIFTVHDILKEKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgcctacttcggcgaatatggtggtcaatacgtaccacaaatttta
gttcctgcacttgatcaacttgagcaagcctttattgatgctcaagcagacgaagatttc
cgtgccgagttcatgacactattgcaagaatatgcgggtcgccctaccgctcttaccctt
tgtcgtaacctaactaagggtactaaaactaagttatacctaaaacgtgaagatttactg
cacggtggcgcgcacaaaaccaatcaagtattgggtcaagcactgctcgctttacgtatg
ggtaaaaaagaaatcatcgctgaaacaggtgccggtcaacacggtgtagcaacggctctt
gcctgcgcattgcttggcttaaaatgccgcgtttacatgggtgctaaagatattgaacgt
caaagcccgaatgtattccgcatggaattaatgggcgcagaagtgatccccgttcattca
ggttcagcaacactaaaagatgcctgtaatgaagcattgcgtgattggtctgcaacgtat
gaaactgcccactacctattgggcactgctgcgggtcctcacccattcccaaccatcgtt
cgcgaattccaacgcatgattggcgaagaaactaaaatgcaaatccttgctcgtgaaggt
cgccttcctgatgccgtaattgcttgtgtcggtggcggctcaaatgcaataggtatgttt
gcggatttcatcaaagaagaaaatgtaagactgattggtgtcgaacccgcaggtaaaggc
attgataccgaccaacacggggcaccattaaaacatggaaaaaccggtattttctttggt
atgaaagcgccattaatgcaagatgaacacggtcaaattgaagaatcttattctgtttct
gcgggtcttgattttccatcagttggtccacaacacgctcacttgaattcgattggccgt
gctgaatacggctcagtaaccgatgatgaagcactcgaagcatttcaaatattagcaaaa
ggcgaaggcattattccggcactggagtcttctcatgcgcttgcttatgcattacaaatg
gcacattcagagccagaaaaagaacaactattagtggtaaacctatctggtcgtggtgat
aaagacattttcaccgttcatgacatcctaaaagaaaagggagaaatctaa

DBGET integrated database retrieval system