KEGG   Aliivibrio salmonicida: VSAL_I1150Help
Entry
VSAL_I1150        CDS       T00782                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain 1
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00260  Glycine, serine and threonine metabolism
vsa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01130  Biosynthesis of antibiotics
vsa01230  Biosynthesis of amino acids
Module
vsa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VSAL_I1150 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VSAL_I1150 (trpB)
Enzymes [BR:vsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VSAL_I1150 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAQ78835
UniProt: B6EJA3
Position
1:complement(1250696..1251886)
Genome map
AA seq 396 aa AA seqDB search
MAKLDAYFGEYGGQYVPQILVPALDQLEQAFIDAQADEDFRAEFMTLLQEYAGRPTALTL
CRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLALRMGKKEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDIERQSPNVFRMELMGAEVIPVHSGSATLKDACNEALRDWSATY
ETAHYLLGTAAGPHPFPTIVREFQRMIGEETKMQILAREGRLPDAVIACVGGGSNAIGMF
ADFIKEENVRLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDEHGQIEESYSVS
AGLDFPSVGPQHAHLNSIGRAEYGSVTDDEALEAFQILAKGEGIIPALESSHALAYALQM
AHSEPEKEQLLVVNLSGRGDKDIFTVHDILKEKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgcctacttcggcgaatatggtggtcaatacgtaccacaaatttta
gttcctgcacttgatcaacttgagcaagcctttattgatgctcaagcagacgaagatttc
cgtgccgagttcatgacactattgcaagaatatgcgggtcgccctaccgctcttaccctt
tgtcgtaacctaactaagggtactaaaactaagttatacctaaaacgtgaagatttactg
cacggtggcgcgcacaaaaccaatcaagtattgggtcaagcactgctcgctttacgtatg
ggtaaaaaagaaatcatcgctgaaacaggtgccggtcaacacggtgtagcaacggctctt
gcctgcgcattgcttggcttaaaatgccgcgtttacatgggtgctaaagatattgaacgt
caaagcccgaatgtattccgcatggaattaatgggcgcagaagtgatccccgttcattca
ggttcagcaacactaaaagatgcctgtaatgaagcattgcgtgattggtctgcaacgtat
gaaactgcccactacctattgggcactgctgcgggtcctcacccattcccaaccatcgtt
cgcgaattccaacgcatgattggcgaagaaactaaaatgcaaatccttgctcgtgaaggt
cgccttcctgatgccgtaattgcttgtgtcggtggcggctcaaatgcaataggtatgttt
gcggatttcatcaaagaagaaaatgtaagactgattggtgtcgaacccgcaggtaaaggc
attgataccgaccaacacggggcaccattaaaacatggaaaaaccggtattttctttggt
atgaaagcgccattaatgcaagatgaacacggtcaaattgaagaatcttattctgtttct
gcgggtcttgattttccatcagttggtccacaacacgctcacttgaattcgattggccgt
gctgaatacggctcagtaaccgatgatgaagcactcgaagcatttcaaatattagcaaaa
ggcgaaggcattattccggcactggagtcttctcatgcgcttgcttatgcattacaaatg
gcacattcagagccagaaaaagaacaactattagtggtaaacctatctggtcgtggtgat
aaagacattttcaccgttcatgacatcctaaaagaaaagggagaaatctaa

DBGET integrated database retrieval system