KEGG   Aliivibrio salmonicida: VSAL_I1855Help
Entry
VSAL_I1855        CDS       T00782                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vsa  Aliivibrio salmonicida
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VSAL_I1855 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VSAL_I1855 (adhE)
   00620 Pyruvate metabolism
    VSAL_I1855 (adhE)
   00650 Butanoate metabolism
    VSAL_I1855 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    VSAL_I1855 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    VSAL_I1855 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VSAL_I1855 (adhE)
   00626 Naphthalene degradation
    VSAL_I1855 (adhE)
Enzymes [BR:vsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VSAL_I1855 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VSAL_I1855 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1989295..1991946
Genome map
AA seq 883 aa AA seqDB search
MPVTNLAELDALVARVKAAQKEFASFSQEQVDTIFRAASLAASTARIELAKMAAEESGMG
IMEDKVIKNHFASEFIYNKYKDELTCGIIDRNDEGGTITIAEPLGIVCAIVPTTNPTSTA
IFKALICLKTRNGCIFSPHPRAKNATNYAAKVVLEAAIKAGAPKDIIGWIDQPSVELSNA
LMKHEHINMILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVSSILMSKTF
DNGVICASEQAAIVVESIYDEVKARFAKYGAVILSKEDANKVRKVLLIDGALNANIVGQP
AYKIAELANVKVPTSTKILIGEGLEASWDDEFAHEKLSPTLGLFKAKDFEDAVRQAGIVL
DIGGVGHTSVLYTDQDNNEERIAYFGDKMKTARILVNTPASQGGIGDLYNFELAPSLTLG
CGSWGGNAISENVGPKHLINKKIVAKRAENMLWHKLPKSIYFRRGCLPIAMSDLEGKKRA
LIVTDRFLFNNGYIDDLRSILKEKGMEVEVFHEVEADPTLAVVKAGAEACASYQPDVILA
VGGGSPMDAAKIMWVMYEHPETDFEDLSMRFMDIRKRIYKFPKMGQKAELVCITTTSGTG
SEVTPFAVVTDEKTGQKYPLADYELTPNMAVVDANLVMDMPKSLCAFGGYDAVTHALEAY
VSVLANEYSDGHALQSLKMLKEYLPSSYANGKKDPIAREKVHNAATIAGMSFAQSFLGVC
HSMAHKLGAEFHIPHGLANALLISNTVRFNATNNPTKQAAFSQYDRPKARARYAEIAEHL
GYRDGNTETKVNALLNWLEELKIALDIPLSIQAAGVNEAEFMAKVDKLAEDAFDDQCTGA
NPRYPLIKELKEVLIASYYGTAYADVMDAPEVKEVVKAKKAKK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaactaatttagctgaacttgatgctctagtagcacgtgttaaagccgcgcaa
aaagaatttgcaagcttttcacaagaacaagttgatacaatatttcgtgctgcgtctcta
gctgcttcaactgctcgtatcgaacttgcaaaaatggcagcagaagagtctggcatgggc
atcatggaagacaaagtaatcaaaaaccattttgcttctgagttcatctacaataaatac
aaagacgaactaacgtgtggcattatcgatcgtaacgatgaaggcggcacgatcacaatc
gctgaacctctaggtattgtttgtgcaatcgttccaacgacaaaccctacttcaacagca
atctttaaagcactaatctgtcttaaaacacgtaatggctgtatcttctcaccgcaccca
cgtgctaaaaatgcaactaactacgctgctaaagtcgtattagaagcagcaattaaagcg
ggcgcaccaaaagacatcattggttggattgaccaaccatctgttgaactatcaaacgca
ctaatgaaacatgaacacatcaacatgatccttgctactggtggtccaggcatggtgaaa
gcggcttattcatcaggtaaaccagctatcggtgttggtgcgggtaatacgcctgtcgtt
atcgatgaaactgctgatatcaaacgtgctgtttcttctatcttaatgtctaaaacattc
gataacggtgttatctgtgcttctgagcaagctgcaattgttgttgagtcaatttacgac
gaagttaaagctcgtttcgctaaatacggcgctgttattttaagcaaagaagacgcaaat
aaagtacgtaaagtactacttattgatggcgcacttaacgctaacatcgttggccaacca
gcatacaaaatcgctgagctagcaaatgttaaagtacctacttctactaaaattcttatc
ggtgaaggcttagaagcttcatgggatgacgaatttgctcatgaaaagctatctcctaca
ttaggtttattcaaagcgaaagactttgaagatgctgtgcgtcaagcaggtatcgtatta
gacataggcggtgttggtcatacgtcagtactttacacagaccaagataacaacgaagaa
cgtattgcgtacttcggtgacaaaatgaaaaccgctcgtattcttgtaaacacgccagca
tctcaaggtggtattggtgacctttacaacttcgaattggctccttcattaacactaggt
tgtggttcttggggtggtaatgctatctctgaaaacgtaggtcctaagcaccttatcaac
aagaaaattgtagctaagcgagcagaaaatatgttgtggcataaactaccaaaatctatc
tacttccgtcgcggctgtttgccaatcgcaatgagcgatcttgaaggtaaaaaacgtgca
ctgatcgttactgaccgtttcttatttaacaacggttacatcgatgatctacgttcaatc
ttgaaagagaaaggcatggaagttgaagtgttccatgaagtagaagcggatcctacatta
gccgtagttaaagcgggtgcagaagcatgtgcaagctaccaacctgatgttatcttagcg
gttggtggtggttcaccaatggatgctgcgaaaatcatgtgggtgatgtacgaacatcca
gaaactgatttcgaagatttatctatgcgctttatggatatccgtaaacgtatttacaag
ttccctaaaatgggccaaaaagctgaactagtatgtattacaactacttcaggtactggt
tctgaagttacaccattcgctgttgtaaccgatgaaaaaacaggtcaaaaatacccatta
gcagattacgagctaacgccaaacatggctgttgttgatgctaaccttgtcatggatatg
cctaagtctttatgtgcattcggtggttacgatgcagtaacgcacgcattagaagcgtat
gtttctgttcttgcaaacgaatactcagatggtcacgctctgcaatcacttaagatgctt
aaagagtacttaccaagctcttacgctaacggtaagaaagatccaatcgcacgtgagaaa
gttcacaatgcagcaacaatcgcaggtatgtcttttgcgcagtctttcctaggtgtgtgt
cactcaatggcgcataaattaggcgctgaattccatattccacacggtcttgctaatgcg
ttattaatctcgaatacggttcgttttaatgcgactaacaacccaactaaacaagcggca
ttctctcagtacgaccgtcctaaagcacgtgctcgttacgctgaaattgcagagcattta
ggttaccgtgatggtaatactgaaacgaaagttaatgcgttacttaactggttagaagag
ctgaaaattgcattggatatcccactgtcaattcaagccgctggcgttaacgaagctgaa
ttcatggctaaagtagacaaattagctgaagatgcatttgatgaccaatgtactggtgct
aacccacgttacccattgatcaaagaacttaaagaagtattaatcgcttcttactacggt
acggcttacgctgacgtaatggacgcaccagaagtgaaagaagtagtaaaagcgaaaaaa
gcaaagaaataa

DBGET integrated database retrieval system